Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

c-JUN Protein – Transcription factor AP-1(JUN)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P05412
Molecular weight:
37.78kDa

Original price was: $273.00.Current price is: $217.00.

50ug 21% OFF + 217 loyalty points
Met1–Phe331
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

c-JUN Protein - Transcription factor AP-1(JUN)

Product name c-JUN Protein - Transcription factor AP-1(JUN)
Uniprot ID P05412
Uniprot link https://www.uniprot.org/uniprot/P05412
Expression system Prokaryotic expression
Raw Antigen Sequence MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Molecular weight 37.78kDa
Purity estimated >90% by SDS-PAGE
Buffer 0.02% Sarcosyl, PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe331
Aliases /Synonyms Activator protein 1,Proto-oncogene c-Jun,V-jun avian sarcoma virus 17 oncogene homolog,p39
Reference PX-P4739
Note For research use only
Molecular Constructor
Met1–Phe331
Product name c-JUN Protein - Transcription factor AP-1(JUN)
Uniprot ID P05412
Uniprot link https://www.uniprot.org/uniprot/P05412
Expression system Prokaryotic expression
Raw Antigen Sequence MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Molecular weight 37.78kDa
Purity estimated >90% by SDS-PAGE
Buffer 0.02% Sarcosyl, PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe331
Aliases /Synonyms Activator protein 1,Proto-oncogene c-Jun,V-jun avian sarcoma virus 17 oncogene homolog,p39
Reference PX-P4739
Note For research use only
Molecular Constructor
Met1–Phe331
Product name PX-P4739-1MG
Uniprot ID P05412
Uniprot link https://www.uniprot.org/uniprot/P05412
Expression system Prokaryotic expression
Raw Antigen Sequence MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Molecular weight 37.78kDa
Purity estimated >90% by SDS-PAGE
Buffer 0.02% Sarcosyl, PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe331
Aliases /Synonyms Activator protein 1,Proto-oncogene c-Jun,V-jun avian sarcoma virus 17 oncogene homolog,p39
Reference PX-P4739
Note For research use only
Molecular Constructor
Met1–Phe331

More Information about c-JUN Protein

C-Jun protein is coded by the JUN gene in humans. This protein, together with c-Fos protein forms the AP-1 transcription factor. Because of its interaction with c-Fos protein, c-Jun protein was initially identified as a Fos-binding protein p39. C-Jun protein is involved in the progression through G1 phase. The role of c-Jun protein is to regulate the activity of cyclin D1 activity which is a Rb kinase. Rb protein is a growth suppressor and is inactivated upon phosphorylation. When c-jun protein is absent, the expression of both p53 and p21 increases which results in cell cycle defects. For this reason, c-jun knockout is lethal. However, transgenic animals that contain c-jun protein that cannot undergo phosphorylation, can survive. In this case cells remain blocked in G1 phase. Upregulation of c-jun protein results in increased cell growth and proliferation which makes c-jun a proto-oncogenic protein.

C-Jun, along with c-Fos protein are highly regulated by different extracellular stimuli such as growth factors, pro-inflammatory cytokines, UV irradiation and oxidative cellular stress. Indeed, increased UV irradiation has been linked to elevated c-jun expression. ERK pathway has also been involved in c-jun expression regulation. Active ERK increases c-jun transcription as well as its stability. The mobilization of c-jun protein leads to the activation of it downstream target RCAK1 which enhances JNK activity. JNK is a kinase that binds to c-jun and double phosphorylates the protein on Ser-63 and Ser-73 of its transcriptional activation domain. Research suggests that the phosphorylation of c-jun protein on threonine 91 and 93 triggers c-jun pro-apoptotic activity . According to Ce et al., (2013) the phosphorylation of c-Jun at threonine 91 and threonine 93 is dependent of threonine 95 which suggested the combination of the three threonines as a sensitive amplifier of the JNK cascade. On the other hand, the JNK triggered survival pathway is inhibited by a survival pathway initiate by lithium which represses pro-apoptotic c-Jun/Ap-1 target genes.

c-JUN Protein - Transcription factor AP-1(JUN)

There are no reviews yet.

Be the first to review “c-JUN Protein – Transcription factor AP-1(JUN)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products