Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Eukaryotic translation initiation factor 4 gamma 1(EIF4G1)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q04637
Molecular weight:
23.49kDa

Original price was: $275.00.Current price is: $250.00.

50ug 9% OFF + 250 loyalty points
Glu557~Lys646
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Eukaryotic translation initiation factor 4 gamma 1(EIF4G1)

Product name Eukaryotic translation initiation factor 4 gamma 1(EIF4G1)
Uniprot ID Q04637
Uniprot link http://www.uniprot.org/uniprot/Q04637
Expression system Prokaryotic expression
Raw Antigen Sequence ESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANK
Molecular weight 23.49kDa
Purity estimated >90% by SDS-PAGE
Buffer 50 mM HEPES, pH 7.2, 100 mM KCl containing 2 mM dithiothreitol and 0.5 mM EDTA.
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu557~Lys646
Aliases /Synonyms EIF4F, EIF4G, EIF4GI,eIF-4-gamma 1,eIF-4G 1,eIF-4G1,p220
Reference PX-P4550
Note For research use only
Molecular Constructor
Glu557~Lys646
Product name Eukaryotic translation initiation factor 4 gamma 1(EIF4G1)
Uniprot ID Q04637
Uniprot link http://www.uniprot.org/uniprot/Q04637
Expression system Prokaryotic expression
Raw Antigen Sequence ESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANK
Molecular weight 23.49kDa
Purity estimated >90% by SDS-PAGE
Buffer 50 mM HEPES, pH 7.2, 100 mM KCl containing 2 mM dithiothreitol and 0.5 mM EDTA.
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu557~Lys646
Aliases /Synonyms EIF4F, EIF4G, EIF4GI,eIF-4-gamma 1,eIF-4G 1,eIF-4G1,p220
Reference PX-P4550
Note For research use only
Molecular Constructor
Glu557~Lys646
Product name PX-P4550-1MG
Uniprot ID Q04637
Uniprot link http://www.uniprot.org/uniprot/Q04637
Expression system Prokaryotic expression
Raw Antigen Sequence ESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANK
Molecular weight 23.49kDa
Purity estimated >90% by SDS-PAGE
Buffer 50 mM HEPES, pH 7.2, 100 mM KCl containing 2 mM dithiothreitol and 0.5 mM EDTA.
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu557~Lys646
Aliases /Synonyms EIF4F, EIF4G, EIF4GI,eIF-4-gamma 1,eIF-4G 1,eIF-4G1,p220
Reference PX-P4550
Note For research use only
Molecular Constructor
Glu557~Lys646

Eukaryotic translation initiation factor 4 gamma 1(EIF4G1)

There are no reviews yet.

Be the first to review “Eukaryotic translation initiation factor 4 gamma 1(EIF4G1)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products