Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Chilli Ca_eIF4E1 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Chilli
Uniprot ID:
Q8GSF9
Molecular weight:
28,15 kDa

Original price was: $298.00.Current price is: $250.00.

50ug 16% OFF + 250 loyalty points
Full-length Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Chilli Ca_eIF4E1 Recombinant Protein

Product name Chilli Ca_eIF4E1 Recombinant Protein
Uniprot ID Q8GSF9
Uniprot link http://www.uniprot.org/uniprot/Q8GSF9
Origin species Chilli
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMMATAEMEKTTTFDEAEKVKLNANEADDEVEEGEIVEETDDTTSYLSKEIATKHPLEHSW TFWFDNPVAKSKQAAWGSSLRNVYTFSTVEDFWGAYNNIHHPSKLVVGADLHCFKHKIEPKWEDPVCANGGTWKMSFSKG KSDTSWLYTLLAMIGHQFDHEDEICGAVVSVRGKGEKISLWTKNAANETAQVSIGKQWKQFLDYSDSVGFIFHDDAKRLD RNAKNRYTV
Molecular weight 28,15 kDa
Protein delivered with Tag? Yes
Purity estimated ≥90%
Buffer PBS1x, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession AAN74644.1
Spec:SwissProtID Q8GSF9
NCBI Reference AAN74644.1
Aliases /Synonyms Ca_eIF4E1, eucaryotic initiation factor 4E, Eukaryotic translation initiation factor 4E
Reference PX-P1077
Note For research use only
Molecular Constructor
Full-length Yes
Product name Chilli Ca_eIF4E1 Recombinant Protein
Uniprot ID Q8GSF9
Uniprot link http://www.uniprot.org/uniprot/Q8GSF9
Origin species Chilli
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMMATAEMEKTTTFDEAEKVKLNANEADDEVEEGEIVEETDDTTSYLSKEIATKHPLEHSW TFWFDNPVAKSKQAAWGSSLRNVYTFSTVEDFWGAYNNIHHPSKLVVGADLHCFKHKIEPKWEDPVCANGGTWKMSFSKG KSDTSWLYTLLAMIGHQFDHEDEICGAVVSVRGKGEKISLWTKNAANETAQVSIGKQWKQFLDYSDSVGFIFHDDAKRLD RNAKNRYTV
Molecular weight 28,15 kDa
Protein delivered with Tag? Yes
Purity estimated ≥90%
Buffer PBS1x, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession AAN74644.1
Spec:SwissProtID Q8GSF9
NCBI Reference AAN74644.1
Aliases /Synonyms Ca_eIF4E1, eucaryotic initiation factor 4E, Eukaryotic translation initiation factor 4E
Reference PX-P1077
Note For research use only
Molecular Constructor
Full-length Yes
Product name PX-P1077-1MG
Uniprot ID Q8GSF9
Uniprot link http://www.uniprot.org/uniprot/Q8GSF9
Origin species Chilli
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMMATAEMEKTTTFDEAEKVKLNANEADDEVEEGEIVEETDDTTSYLSKEIATKHPLEHSW TFWFDNPVAKSKQAAWGSSLRNVYTFSTVEDFWGAYNNIHHPSKLVVGADLHCFKHKIEPKWEDPVCANGGTWKMSFSKG KSDTSWLYTLLAMIGHQFDHEDEICGAVVSVRGKGEKISLWTKNAANETAQVSIGKQWKQFLDYSDSVGFIFHDDAKRLD RNAKNRYTV
Molecular weight 28,15 kDa
Protein delivered with Tag? Yes
Purity estimated ≥90%
Buffer PBS1x, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession AAN74644.1
Spec:SwissProtID Q8GSF9
NCBI Reference AAN74644.1
Aliases /Synonyms Ca_eIF4E1, eucaryotic initiation factor 4E, Eukaryotic translation initiation factor 4E
Reference PX-P1077
Note For research use only
Molecular Constructor
Full-length Yes

General information on Chilli Ca_eIF4E1 Recombinant Protein:

eIF4E1 Recombinant Protein from Capsicum annuum (Bell pepper) is a central element of the initiation complex of mRNA translation in eukaryotes. The eIF4E gene is coexpressed with the Tobacco etch virus (TEV) genome, it exerts a positive effect on viral amplification.

Chilli Ca_eIF4E1 Recombinant Protein

  • Charron C, Nicolaï M, Gallois JL, Robaglia C, Moury B, Palloix A, Caranta C. Natural variation and functional analyses provide evidence for co-evolution between plant eIF4E and potyviral VPg. Plant J. 2008 Apr;54(1):56-68. doi: 10.1111/j.1365-313X.2008.03407.x. Epub 2008 Jan 7. PubMed PMID: 18182024.
  • Kang BC, Yeam I, Frantz JD, Murphy JF, Jahn MM. The pvr1 locus in Capsicum encodes a translation initiation factor eIF4E that interacts with Tobacco etch virus VPg. Plant J. 2005 May;42(3):392-405. PubMed PMID: 15842624.
  • Ruffel S, Dussault MH, Palloix A, Moury B, Bendahmane A, Robaglia C, Caranta C. A natural recessive resistance gene against potato virus Y in pepper corresponds to the eukaryotic initiation factor 4E (eIF4E). Plant J. 2002 Dec;32(6):1067-75. PubMed PMID: 12492847.

There are no reviews yet.

Be the first to review “Chilli Ca_eIF4E1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products