Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CAV1 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q03135
Molecular weight:
12.71 kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CAV1 Recombinant Protein

Product name Human CAV1 Recombinant Protein
Uniprot ID Q03135
Uniprot link http://www.uniprot.org/uniprot/Q03135
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLS
Molecular weight 12.71 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference Q03135
Aliases /Synonyms VIP21, Caveolae Protein 22kDa, Caveolin 1, CAV1
Reference PX-P3038
Note For research use only
Molecular Constructor
Partial Yes
Product name Human CAV1 Recombinant Protein
Uniprot ID Q03135
Uniprot link http://www.uniprot.org/uniprot/Q03135
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLS
Molecular weight 12.71 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference Q03135
Aliases /Synonyms VIP21, Caveolae Protein 22kDa, Caveolin 1, CAV1
Reference PX-P3038
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human CAV1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products