Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Arginase-1(ARG1)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P05089
Molecular weight:
34.74 kDa

Original price was: $280.00.Current price is: $250.00.

50ug 11% OFF + 250 loyalty points
His Met1–Lys322
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Arginase-1(ARG1)

Product name Arginase-1(ARG1)
Uniprot ID P05089
Uniprot link https://www.uniprot.org/uniprot/P05089
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Molecular weight 34.74 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys322
Protein Accession P05089
Spec:Entrez GeneID 383
Spec:SwissProtID Q9BS50
NCBI Reference P05089
Aliases /Synonyms Liver-type arginase,Type I arginase
Reference PX-P4777
Note For research use only
Molecular Constructor
His Met1–Lys322
Product name Arginase-1(ARG1)
Uniprot ID P05089
Uniprot link https://www.uniprot.org/uniprot/P05089
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Molecular weight 34.74 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys322
Protein Accession P05089
Spec:Entrez GeneID 383
Spec:SwissProtID Q9BS50
NCBI Reference P05089
Aliases /Synonyms Liver-type arginase,Type I arginase
Reference PX-P4777
Note For research use only
Molecular Constructor
His Met1–Lys322
Product name PX-P4777-1MG
Uniprot ID P05089
Uniprot link https://www.uniprot.org/uniprot/P05089
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Molecular weight 34.74 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys322
Protein Accession P05089
Spec:Entrez GeneID 383
Spec:SwissProtID Q9BS50
NCBI Reference P05089
Aliases /Synonyms Liver-type arginase,Type I arginase
Reference PX-P4777
Note For research use only
Molecular Constructor
His Met1–Lys322

Arginase-1(ARG1)

There are no reviews yet.

Be the first to review “Arginase-1(ARG1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products