Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Mouse BRP-39 Recombinant Protein

  • PX-P1075-10
Host species:
Escherichia coli (E.coli)
Origin species:
House Mouse
Uniprot ID:
Q61362
Molecular weight:
42,30 kDa

$392.00

+ 392 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Mouse BRP-39 Recombinant Protein

Mouse BRP-39 Recombinant Protein

Product name Mouse BRP-39 Recombinant Protein
Uniprot ID Q61362
Uniprot link http://www.uniprot.org/uniprot/Q61362
Origin species House Mouse
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMYKLVCYFTSWSQYREGVGSFLPDAIQPFLCTHIIYSFANISSDNMLSTWEWNDESNYDKLNKLKTRNT NLKTLLSVGGWKFGEKRFSEIASNTERRTAFVRSVAPFLRSYGFDGLDLAWLYPRLRDKQYFSTLIKELNAEFTKEVQPG REKLLLSAALSAGKVAIDTGYDIAQIAQHLDFINLMTYDFHGVWRQITGHHSPLFQGQKDTRFDRYSNVNYAVQYMIRLG AQASKLLMGIPTFGKSFTLASSENQLGAPISGEGLPGRFTKEAGTLAYYEICDFLKGAEVHRLSNEKVPFATKGNQWVGY EHKESVKNKVGFLKEKKLAGAMVWALDLDDFQGTCQPKEFFPLTNAIKDALA
Molecular weight 42,30 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, imidazole 10mM, Urea 8M, pH4
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession CAA63603.1
Spec:Entrez GeneID 12654
Spec:NCBI Gene Aliases Brp39, AW208766, Chi3l1, Gp39
Spec:SwissProtID Q61362
NCBI Reference CAA63603.1
Aliases /Synonyms BRP-39, BRP39 protein, Chitinase-3-like protein 1, Chi3l1
Reference PX-P1075
Note For research use only
Molecular Constructor
Partial Yes
Product name Mouse BRP-39 Recombinant Protein
Uniprot ID Q61362
Uniprot link http://www.uniprot.org/uniprot/Q61362
Origin species House Mouse
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMYKLVCYFTSWSQYREGVGSFLPDAIQPFLCTHIIYSFANISSDNMLSTWEWNDESNYDKLNKLKTRNT NLKTLLSVGGWKFGEKRFSEIASNTERRTAFVRSVAPFLRSYGFDGLDLAWLYPRLRDKQYFSTLIKELNAEFTKEVQPG REKLLLSAALSAGKVAIDTGYDIAQIAQHLDFINLMTYDFHGVWRQITGHHSPLFQGQKDTRFDRYSNVNYAVQYMIRLG AQASKLLMGIPTFGKSFTLASSENQLGAPISGEGLPGRFTKEAGTLAYYEICDFLKGAEVHRLSNEKVPFATKGNQWVGY EHKESVKNKVGFLKEKKLAGAMVWALDLDDFQGTCQPKEFFPLTNAIKDALA
Molecular weight 42,30 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, imidazole 10mM, Urea 8M, pH4
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession CAA63603.1
Spec:Entrez GeneID 12654
Spec:NCBI Gene Aliases Brp39, AW208766, Chi3l1, Gp39
Spec:SwissProtID Q61362
NCBI Reference CAA63603.1
Aliases /Synonyms BRP-39, BRP39 protein, Chitinase-3-like protein 1, Chi3l1
Reference PX-P1075
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Mouse BRP-39 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products