Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

DNA repair protein RAD51 homolog 2(Rad51b)

Host species:
Escherichia coli (E.coli)
Origin species:
House Mouse
Uniprot ID:
O35719

$250.00

+ 250 loyalty points
Met121–Pro350
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
DNA repair protein RAD51 homolog 2(Rad51b)

DNA repair protein RAD51 homolog 2(Rad51b)

Product name DNA repair protein RAD51 homolog 2(Rad51b)
Uniprot ID O35719
Uniprot link https://www.uniprot.org/uniprot/O35719
Origin species House Mouse
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGMSVLATLPTSLGGLEGAVVYIDTESAFTAERLVEIAESRFPQYFNTEEKLLLTSSRVHLCRELTCEGLLQRLESLEEEIISKGVKLVIVDSIASVVRKEFDPKLQGNIKERNKFLGKGASLLKYLAGEFSIPVILTNQITTHLSGALPSQADLVSPADDLSLSEGTSGSSCLVAALGNTWGHCVNTRLILQYLDSERRQILIAKSPLAAFTSFVYTIKGEGLVLQGHERP
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met121-Pro350
Aliases /Synonyms R51H2,RAD51 homolog B,RAD51-like protein 1,Rad51l1, Rec2
Reference PX-P4811
Note For research use only
Molecular Constructor
Met121–Pro350
Product name DNA repair protein RAD51 homolog 2(Rad51b)
Uniprot ID O35719
Uniprot link https://www.uniprot.org/uniprot/O35719
Origin species House Mouse
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGMSVLATLPTSLGGLEGAVVYIDTESAFTAERLVEIAESRFPQYFNTEEKLLLTSSRVHLCRELTCEGLLQRLESLEEEIISKGVKLVIVDSIASVVRKEFDPKLQGNIKERNKFLGKGASLLKYLAGEFSIPVILTNQITTHLSGALPSQADLVSPADDLSLSEGTSGSSCLVAALGNTWGHCVNTRLILQYLDSERRQILIAKSPLAAFTSFVYTIKGEGLVLQGHERP
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met121-Pro350
Aliases /Synonyms R51H2,RAD51 homolog B,RAD51-like protein 1,Rad51l1, Rec2
Reference PX-P4811
Note For research use only
Molecular Constructor
Met121–Pro350

There are no reviews yet.

Be the first to review “DNA repair protein RAD51 homolog 2(Rad51b)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products