Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

ETS homologous factor (Ehf )

Host species:
Escherichia coli (E.coli)
Origin species:
House Mouse
Uniprot ID:
O70273
Molecular weight:
14.97kDa

Original price was: $109.00.Current price is: $99.00.

50ug 9% OFF + 99 loyalty points
Met1–Asn127 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

ETS homologous factor (Ehf )

Product name ETS homologous factor (Ehf )
Uniprot ID O70273
Uniprot link https://www.uniprot.org/uniprot/O70273
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MILEGSGVMNLNPANNLLHQQPAWTDSYPTCNVSSGFFGSQWHEIHPQYWTKYQVWEWLQHLLDTNQLDASCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSDLFQSAHNLEHHHHHH
Molecular weight 14.97kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn127
Protein Accession O70273
Spec:Entrez GeneID 13661
Spec:NCBI Gene Aliases AU019492; 9030625L19Rik
Spec:SwissProtID Q922E8
NCBI Reference O70273
Aliases /Synonyms ETS domain-containing transcription factor
Reference PX-P4620
Note For research use only
Molecular Constructor
Met1–Asn127 His
Product name ETS homologous factor (Ehf )
Uniprot ID O70273
Uniprot link https://www.uniprot.org/uniprot/O70273
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MILEGSGVMNLNPANNLLHQQPAWTDSYPTCNVSSGFFGSQWHEIHPQYWTKYQVWEWLQHLLDTNQLDASCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSDLFQSAHNLEHHHHHH
Molecular weight 14.97kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn127
Protein Accession O70273
Spec:Entrez GeneID 13661
Spec:NCBI Gene Aliases AU019492; 9030625L19Rik
Spec:SwissProtID Q922E8
NCBI Reference O70273
Aliases /Synonyms ETS domain-containing transcription factor
Reference PX-P4620
Note For research use only
Molecular Constructor
Met1–Asn127 His
Product name PX-P4620-1MG
Uniprot ID O70273
Uniprot link https://www.uniprot.org/uniprot/O70273
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MILEGSGVMNLNPANNLLHQQPAWTDSYPTCNVSSGFFGSQWHEIHPQYWTKYQVWEWLQHLLDTNQLDASCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSDLFQSAHNLEHHHHHH
Molecular weight 14.97kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn127
Protein Accession O70273
Spec:Entrez GeneID 13661
Spec:NCBI Gene Aliases AU019492; 9030625L19Rik
Spec:SwissProtID Q922E8
NCBI Reference O70273
Aliases /Synonyms ETS domain-containing transcription factor
Reference PX-P4620
Note For research use only
Molecular Constructor
Met1–Asn127 His

ETS homologous factor (Ehf )

There are no reviews yet.

Be the first to review “ETS homologous factor (Ehf )”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products