Name: Integrator complex subunit 3(Ints3)
SKU: PX-P4683-10
Availability: InStock

Product name	Integrator complex subunit 3(Ints3)
Uniprot ID	Q7TPD0
Uniprot link	https://www.uniprot.org/uniprot/Q7TPD0
Origin species	House Mouse
Expression system	Prokaryotic expression
Sequence	MGTEESLEESVGKPLYLIFRNLCQMQEDNSSFSLLLDLLSELYQKQPKIGYHLLYYLRASKAAAGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLLCHLTPSIYTEFPDETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQSLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLRREKPSEEMVKMVLSRPCHPDDQFTTSILRHWCMKHDELLAEHIKSLEHHHHHH
Molecular weight	28.83kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Applications	ELISA,WB
Fragment Type	Thr639-Lys891
Protein Accession	Q7TPD0
Spec:Entrez GeneID	229543
Spec:NCBI Gene Aliases	C77668
Spec:SwissProtID	Q99LK7
NCBI Reference	Q7TPD0
Aliases /Synonyms	Int3, SOSS complex subunit A,Sensor of single-strand DNA complex subunit A,SOSS-A,Sensor of ssDNA subunit A
Reference	PX-P4683
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Integrator complex subunit 3(Ints3)”

Size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17851 189$

View product