Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Integrator complex subunit 3(Ints3)

Origin species:
House Mouse
Uniprot ID:
Q7TPD0
Molecular weight:
28.83kDa

Original price was: $113.00.Current price is: $99.00.

50ug 12% OFF + 99 loyalty points
Thr639–Lys891 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Integrator complex subunit 3(Ints3)

Product name Integrator complex subunit 3(Ints3)
Uniprot ID Q7TPD0
Uniprot link https://www.uniprot.org/uniprot/Q7TPD0
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TEESLEESVGKPLYLIFRNLCQMQEDNSSFSLLLDLLSELYQKQPKIGYHLLYYLRASKAAAGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLLCHLTPSIYTEFPDETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQSLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLRREKPSEEMVKMVLSRPCHPDDQFTTSILRHWCMKHDELLAEHIK
Molecular weight 28.83kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Fragment Type Thr639-Lys891
Protein Accession Q7TPD0
Spec:Entrez GeneID 229543
Spec:NCBI Gene Aliases C77668
Spec:SwissProtID Q99LK7
NCBI Reference Q7TPD0
Aliases /Synonyms Int3, SOSS complex subunit A,Sensor of single-strand DNA complex subunit A,SOSS-A,Sensor of ssDNA subunit A
Reference PX-P4683
Note For research use only
Molecular Constructor
Thr639–Lys891 His
Product name Integrator complex subunit 3(Ints3)
Uniprot ID Q7TPD0
Uniprot link https://www.uniprot.org/uniprot/Q7TPD0
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TEESLEESVGKPLYLIFRNLCQMQEDNSSFSLLLDLLSELYQKQPKIGYHLLYYLRASKAAAGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLLCHLTPSIYTEFPDETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQSLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLRREKPSEEMVKMVLSRPCHPDDQFTTSILRHWCMKHDELLAEHIK
Molecular weight 28.83kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Fragment Type Thr639-Lys891
Protein Accession Q7TPD0
Spec:Entrez GeneID 229543
Spec:NCBI Gene Aliases C77668
Spec:SwissProtID Q99LK7
NCBI Reference Q7TPD0
Aliases /Synonyms Int3, SOSS complex subunit A,Sensor of single-strand DNA complex subunit A,SOSS-A,Sensor of ssDNA subunit A
Reference PX-P4683
Note For research use only
Molecular Constructor
Thr639–Lys891 His
Product name PX-P4683-1MG
Uniprot ID Q7TPD0
Uniprot link https://www.uniprot.org/uniprot/Q7TPD0
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TEESLEESVGKPLYLIFRNLCQMQEDNSSFSLLLDLLSELYQKQPKIGYHLLYYLRASKAAAGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLLCHLTPSIYTEFPDETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQSLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLRREKPSEEMVKMVLSRPCHPDDQFTTSILRHWCMKHDELLAEHIK
Molecular weight 28.83kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Fragment Type Thr639-Lys891
Protein Accession Q7TPD0
Spec:Entrez GeneID 229543
Spec:NCBI Gene Aliases C77668
Spec:SwissProtID Q99LK7
NCBI Reference Q7TPD0
Aliases /Synonyms Int3, SOSS complex subunit A,Sensor of single-strand DNA complex subunit A,SOSS-A,Sensor of ssDNA subunit A
Reference PX-P4683
Note For research use only
Molecular Constructor
Thr639–Lys891 His

Integrator complex subunit 3(Ints3)

There are no reviews yet.

Be the first to review “Integrator complex subunit 3(Ints3)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products