Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human SR-BI Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q8WTV0
Molecular weight:
23,24 kDa

Original price was: $305.00.Current price is: $250.00.

50ug 18% OFF + 250 loyalty points
Partial Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human SR-BI Recombinant Protein

Product name Human SR-BI Recombinant Protein
Uniprot ID Q8WTV0
Uniprot link http://www.uniprot.org/uniprot/Q8WTV0
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLTFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFM NRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCN MINGTSGQMWPPFMTPESSLEFYSPEACRSMKLMYKESGVFE
Molecular weight 23,24 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, Urea 8M, imidazole 400mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_005496.4
Spec:Entrez GeneID 949
Spec:NCBI Gene Aliases CD36L1, HDLQTL6, CLA-1, SRB1, SR-BI, CLA1
Spec:SwissProtID Q8WTV0
NCBI Reference NP_005496.4
Aliases /Synonyms SR-BI [310-882], scavenger receptor class B, member 1
Reference PX-P1156
Note For research use only
Molecular Constructor
Partial Yes
Product name Human SR-BI Recombinant Protein
Uniprot ID Q8WTV0
Uniprot link http://www.uniprot.org/uniprot/Q8WTV0
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLTFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFM NRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCN MINGTSGQMWPPFMTPESSLEFYSPEACRSMKLMYKESGVFE
Molecular weight 23,24 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, Urea 8M, imidazole 400mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_005496.4
Spec:Entrez GeneID 949
Spec:NCBI Gene Aliases CD36L1, HDLQTL6, CLA-1, SRB1, SR-BI, CLA1
Spec:SwissProtID Q8WTV0
NCBI Reference NP_005496.4
Aliases /Synonyms SR-BI [310-882], scavenger receptor class B, member 1
Reference PX-P1156
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P1156-1MG
Uniprot ID Q8WTV0
Uniprot link http://www.uniprot.org/uniprot/Q8WTV0
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLTFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFM NRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCN MINGTSGQMWPPFMTPESSLEFYSPEACRSMKLMYKESGVFE
Molecular weight 23,24 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, Urea 8M, imidazole 400mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_005496.4
Spec:Entrez GeneID 949
Spec:NCBI Gene Aliases CD36L1, HDLQTL6, CLA-1, SRB1, SR-BI, CLA1
Spec:SwissProtID Q8WTV0
NCBI Reference NP_005496.4
Aliases /Synonyms SR-BI [310-882], scavenger receptor class B, member 1
Reference PX-P1156
Note For research use only
Molecular Constructor
Partial Yes

Human SR-BI Recombinant Protein

There are no reviews yet.

Be the first to review “Human SR-BI Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products