Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human Efa_120 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P78417
Molecular weight:
26,79 kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human Efa_120 Recombinant Protein

Human Efa_120 Recombinant Protein

Product name Human Efa_120 Recombinant Protein
Uniprot ID P78417
Uniprot link http://www.uniprot.org/uniprot/P78417
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLPRVNSGLRCATMSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKN KPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKED YAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTV
Molecular weight 26,79 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession CAD97673.1
Spec:Entrez GeneID 9446
Spec:NCBI Gene Aliases SPG-R, GSTO 1-1, GSTTLp28, P28, HEL-S-21
Spec:SwissProtID P78417
NCBI Reference CAD97673.1
Aliases /Synonyms Efa_120, hypothetical protein, Glutathione S-transferase omega-1, GSTO1, GSTO-1, Glutathione S-transferase omega 1-1, GSTO 1-1, Glutathione-dependent dehydroascorbate reductase, Monomethylarsonic acid reductase, MMA(V) reductase, S-(Phenacyl)glutathione reductase, SPG-R
Reference PX-P1085
Note For research use only
Molecular Constructor
Partial Yes
Product name Human Efa_120 Recombinant Protein
Uniprot ID P78417
Uniprot link http://www.uniprot.org/uniprot/P78417
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLPRVNSGLRCATMSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKN KPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKED YAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTV
Molecular weight 26,79 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession CAD97673.1
Spec:Entrez GeneID 9446
Spec:NCBI Gene Aliases SPG-R, GSTO 1-1, GSTTLp28, P28, HEL-S-21
Spec:SwissProtID P78417
NCBI Reference CAD97673.1
Aliases /Synonyms Efa_120, hypothetical protein, Glutathione S-transferase omega-1, GSTO1, GSTO-1, Glutathione S-transferase omega 1-1, GSTO 1-1, Glutathione-dependent dehydroascorbate reductase, Monomethylarsonic acid reductase, MMA(V) reductase, S-(Phenacyl)glutathione reductase, SPG-R
Reference PX-P1085
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human Efa_120 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products