Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P25445
Molecular weight:
16.64 kDa

$169.00

100ug + 169 loyalty points
His Gln26–Asn173
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Tumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173)

Product name Tumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173)
Uniprot ID P25445
Uniprot link https://www.uniprot.org/uniprot/P25445
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHF SSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEG SRSN
Molecular weight 16.64 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln26-Asn173
Protein Accession P25445
Spec:Entrez GeneID 355
Spec:NCBI Gene Aliases APT1; CD95; FAS1; APO-1; FASTM; ALPS1A; TNFRSF6
Spec:SwissProtID Q6SSE9
NCBI Reference P25445
Aliases /Synonyms APT1, FAS1, TNFRSF6,Apo-1 antigen,Apoptosis-mediating surface antigen FAS,FASLG receptor, CD95
Reference PX-P4778
Note For research use only
Molecular Constructor
His Gln26–Asn173
Product name Tumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173)
Uniprot ID P25445
Uniprot link https://www.uniprot.org/uniprot/P25445
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHF SSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEG SRSN
Molecular weight 16.64 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln26-Asn173
Protein Accession P25445
Spec:Entrez GeneID 355
Spec:NCBI Gene Aliases APT1; CD95; FAS1; APO-1; FASTM; ALPS1A; TNFRSF6
Spec:SwissProtID Q6SSE9
NCBI Reference P25445
Aliases /Synonyms APT1, FAS1, TNFRSF6,Apo-1 antigen,Apoptosis-mediating surface antigen FAS,FASLG receptor, CD95
Reference PX-P4778
Note For research use only
Molecular Constructor
His Gln26–Asn173

Tumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173)

There are no reviews yet.

Be the first to review “Tumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products