Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human IL33 isoform 1 partial (112-270) recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O95760
Molecular weight:
19.92kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human IL33 isoform 1 partial (112-270) recombinant protein

Human IL33 isoform 1 partial (112-270) recombinant protein

Product name Human IL33 isoform 1 partial (112-270) recombinant protein
Uniprot ID O95760
Uniprot link http://www.uniprot.org/uniprot/O95760
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGDDDDKMSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Molecular weight 19.92kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Aliases /Synonyms DV27, C9ORF26, IL1F11, NFHEV, Interleukin-1 Family, Member 11, Nuclear factor from high endothelial venules, Interleukin 33, IL33,IL33 isoform 1 partial (112-270)
Reference PX-P4020
Note For research use only
Molecular Constructor
Partial Yes
Product name Human IL33 isoform 1 partial (112-270) recombinant protein
Uniprot ID O95760
Uniprot link http://www.uniprot.org/uniprot/O95760
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGDDDDKMSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Molecular weight 19.92kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Aliases /Synonyms DV27, C9ORF26, IL1F11, NFHEV, Interleukin-1 Family, Member 11, Nuclear factor from high endothelial venules, Interleukin 33, IL33,IL33 isoform 1 partial (112-270)
Reference PX-P4020
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human IL33 isoform 1 partial (112-270) recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products