Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human GITR recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9Y5U5
Molecular weight:
16.84 kDa

$392.00

100ug + 392 loyalty points
His Gln26–Glu161
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human GITR recombinant protein

Product name Human GITR recombinant protein
Uniprot ID Q9Y5U5
Uniprot link https://www.uniprot.org/uniprot/Q9Y5U5
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPA
Molecular weight 16.84 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln26-Glu161
Aliases /Synonyms Activation-inducible TNFR family receptor, GITR, TNFRSF18, CD357, Tumor necrosis factor receptor superfamily member 18, AITR, Glucocorticoid-induced TNFR-related protein
Reference PX-P6015
Note For research use only
Molecular Constructor
His Gln26–Glu161

Human GITR recombinant protein

There are no reviews yet.

Be the first to review “Human GITR recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products