Brand: ProteoGenix

Human CD40 ligand recombinant protein

PX-P4016-10
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Homo sapiens (Human)
Uniprot ID:: P63304
Molecular weight:: 17.95kDa

$250.00

+ 250 loyalty points

Partial Yes

Size Size

50ug $250.00
100ug $459.00

Clear

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Human CD40 ligand recombinant protein

Product name	Human CD40 ligand recombinant protein
Uniprot ID	P63304
Uniprot link	http://www.uniprot.org/uniprot/P63304
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQ APFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKLLEHHH HHH
Molecular weight	17.95kDa
Protein delivered with Tag?	Yes
Purity estimated	85%
Buffer	50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Aliases /Synonyms	CD40L, CD154, TRAP, HIGM1, IGM, IMD3, TBAM, T-BAM, TNFSF5, Gp39, TNF Superfamily Member 5, Hyper-IgM Syndrome, TNF-Related Activation Protein, T-Cell B-Cell Activating Molecule
Reference	PX-P4016
Note	For research use only
Molecular Constructor	Partial Yes

Product name	Human CD40 ligand recombinant protein
Uniprot ID	P63304
Uniprot link	http://www.uniprot.org/uniprot/P63304
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQ APFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKLLEHHH HHH
Molecular weight	17.95kDa
Protein delivered with Tag?	Yes
Purity estimated	85%
Buffer	50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Aliases /Synonyms	CD40L, CD154, TRAP, HIGM1, IGM, IMD3, TBAM, T-BAM, TNFSF5, Gp39, TNF Superfamily Member 5, Hyper-IgM Syndrome, TNF-Related Activation Protein, T-Cell B-Cell Activating Molecule
Reference	PX-P4016
Note	For research use only
Molecular Constructor	Partial Yes

There are no reviews yet.

Be the first to review “Human CD40 ligand recombinant protein”

Human CD40 ligand recombinant protein

Human CD40 ligand recombinant protein

Related products

Garivulimab Biosimilar – Anti-CD274 mAb – Research Grade

Opucolimab Biosimilar – Anti-PDL1 mAb – Research Grade

Sibeprenlimab Biosimilar – Anti-TNFSF13 mAb – Research Grade

Sudubrilimab Biosimilar – Anti-CD274 mAb – Research Grade

Sugemalimab Biosimilar – Anti-PDL1 mAb – Research Grade

Tarlatamab Biosimilar – Anti-DLL3;CD3E mAb – Research Grade

BMS-936559/MDX-1105 Biosimilar – Anti-B7-H1 mAb – Research Grade

Rozipafusp alfa Biosimilar – Anti-B7RP1 mAb – Research Grade

Toralizumab Biosimilar – Anti-sCD40L mAb – Research Grade

TNFRSF10B recombinant protein

CD40 ligand(CD40LG)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human CD40 ligand recombinant protein

Specifications Human CD40 ligand recombinant protein

Documents

Reviews

Related products

Garivulimab Biosimilar – Anti-CD274 mAb – Research Grade

Opucolimab Biosimilar – Anti-PDL1 mAb – Research Grade

Sibeprenlimab Biosimilar – Anti-TNFSF13 mAb – Research Grade

Sudubrilimab Biosimilar – Anti-CD274 mAb – Research Grade

Sugemalimab Biosimilar – Anti-PDL1 mAb – Research Grade

Tarlatamab Biosimilar – Anti-DLL3;CD3E mAb – Research Grade

BMS-936559/MDX-1105 Biosimilar – Anti-B7-H1 mAb – Research Grade

Rozipafusp alfa Biosimilar – Anti-B7RP1 mAb – Research Grade

Toralizumab Biosimilar – Anti-sCD40L mAb – Research Grade

TNFRSF10B recombinant protein

CD40 ligand(CD40LG)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human CD40 ligand recombinant protein