Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rozipafusp alfa Biosimilar – Anti-B7RP1 mAb – Research Grade

  • PX-TA1920-50
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG2, Kappa

Original price was: $218.00.Current price is: $167.00.

50ug 23% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Rozipafusp alfa Biosimilar - Anti-B7RP1 mAb - Research Grade

Product name Rozipafusp alfa Biosimilar - Anti-B7RP1 mAb - Research Grade
Uniprot ID O75144 & Q9Y275
Source CAS: 2143449-47-0
Species Homo sapiens
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-B7RP1,B7-related protein 1,CD275,ICOSL,ICOSLG,KIAA0653,B7 homolog 2,ICOS ligand,B7RP-1,B7H2,B7-H2,B7-like protein Gl50,
Reference PX-TA1920
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name Rozipafusp alfa Biosimilar - Anti-B7RP1 mAb - Research Grade
Uniprot ID O75144 & Q9Y275
Source CAS: 2143449-47-0
Species Homo sapiens
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-B7RP1,B7-related protein 1,CD275,ICOSL,ICOSLG,KIAA0653,B7 homolog 2,ICOS ligand,B7RP-1,B7H2,B7-H2,B7-like protein Gl50,
Reference PX-TA1920
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name PX-TA1920-50
Uniprot ID O75144 & Q9Y275
Source CAS: 2143449-47-0
Species Homo sapiens
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-B7RP1,B7-related protein 1,CD275,ICOSL,ICOSLG,KIAA0653,B7 homolog 2,ICOS ligand,B7RP-1,B7H2,B7-H2,B7-like protein Gl50,
Reference PX-TA1920
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody

Rozipafusp alfa Biosimilar – Anti-B7RP1 mAb: A Novel Therapeutic Antibody Targeting B7RP1 Rozipafusp alfa Biosimilar, also known as Anti-B7RP1 mAb, is a novel therapeutic antibody that has been developed as a biosimilar to the original Rozipafusp alfa antibody. This biosimilar has been specifically designed to target B7RP1, a protein that plays a crucial role in immune regulation and has been identified as a potential therapeutic target for various diseases.

Structure of Rozipafusp alfa Biosimilar

Rozipafusp alfa Biosimilar is a monoclonal antibody (mAb) that is produced through recombinant DNA technology. It is a fully humanized antibody, meaning that it is derived from human genetic material, which reduces the risk of immunogenicity and enhances its efficacy. The antibody has a molecular weight of approximately 150 kDa and consists of two identical heavy chains and two identical light chains, connected by disulfide bonds.

The variable regions of the antibody, which are responsible for binding to the target protein, have been engineered to have high affinity and specificity for B7RP1. This allows Rozipafusp alfa Biosimilar to effectively bind to and inhibit the activity of B7RP1, leading to its therapeutic effects.

Mechanism of Action

The main mechanism of action of Rozipafusp alfa Biosimilar is through its binding to B7RP1. B7RP1 is a co-stimulatory protein that is expressed on the surface of various immune cells, including T cells, B cells, and dendritic cells. When B7RP1 binds to its receptor, ICOS, it activates immune cells and promotes their proliferation and cytokine production.

By binding to B7RP1, Rozipafusp alfa Biosimilar blocks the interaction between B7RP1 and ICOS, thereby inhibiting the activation of immune cells. This leads to a decrease in the production of pro-inflammatory cytokines and an increase in the production of anti-inflammatory cytokines, resulting in the regulation of the immune response.

Applications of Rozipafusp alfa Biosimilar

Rozipafusp alfa Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of various diseases. Its main therapeutic applications include:

  • Inflammatory Diseases: B7RP1 has been implicated in the pathogenesis of various inflammatory diseases, such as rheumatoid arthritis, psoriasis, and inflammatory bowel disease. By targeting B7RP1, Rozipafusp alfa Biosimilar has the potential to reduce inflammation and improve symptoms in these conditions.
  • Cancer: B7RP1 has also been found to play a role in cancer progression and immune evasion. By inhibiting B7RP1, Rozipafusp alfa Biosimilar may enhance the anti-tumor immune response and improve the efficacy of cancer treatments.
  • Transplant Rejection: B7RP1 is involved in the activation of T cells, which can lead to transplant rejection. By blocking B7RP1, Rozipafusp alfa Biosimilar has the potential to prevent transplant rejection and improve transplant outcomes.

Conclusion

Rozipafusp alfa Biosimilar is a novel therapeutic antibody that has been specifically designed to target B7RP1, a protein involved in immune regulation. Its unique structure and mechanism of action make it a promising candidate for the treatment of various diseases, including inflammatory diseases, cancer, and transplant rejection. As clinical trials continue to evaluate its efficacy and safety, Rozipafusp alfa Biosimilar has the potential to become a valuable addition to the arsenal of therapeutic antibodies.

Flow Cytometry results for Rozibafusp alfa Biosimilar - Anti-CD275;ICOSLG and CD257;BAFF mAb - Research Grade

Flow Cytometry results for Rozibafusp alfa Biosimilar - Anti-CD275;ICOSLG and CD257;BAFF mAb - Research Grade

Flow-cytometry using anti-human CD275 antibody. U937 cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human CD275 monoclonal antibody (Catalog: PX-TA1920, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a Goat Anti-Human IgG H&L Polyclonal Antibody, FITC (abinScience: PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Rozipafusp alfa Biosimilar - Anti-B7RP1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Rozipafusp alfa Biosimilar – Anti-B7RP1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products