Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

TNFRSF10B recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O14763
Molecular weight:
47.74 kDa

Original price was: $315.00.Current price is: $274.00.

50ug 13% OFF + 274 loyalty points
Ser234–Ala435 GST
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

TNFRSF10B recombinant protein

Product name PX-P5189-100
Uniprot ID O14763
Uniprot link https://www.uniprot.org/uniprot/O14763
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SLLWKKVLPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGVNMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRKLGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIEDHLLSSGKFMYLEGNA
Molecular weight 47.74 kDa
Protein delivered with Tag? GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser234-Ala435
Protein Accession O14763
Aliases /Synonyms Tumor necrosis factor receptor superfamily member 10B,Death receptor 5,TNF-related apoptosis-inducing ligand receptor 2,TRAIL receptor 2,TRAIL-R2,CD262.
Reference PX-P5189
Note For research use only
Molecular Constructor
Ser234–Ala435 GST
Product name PX-P5189-1MG
Uniprot ID O14763
Uniprot link https://www.uniprot.org/uniprot/O14763
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SLLWKKVLPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGVNMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRKLGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIEDHLLSSGKFMYLEGNA
Molecular weight 47.74 kDa
Protein delivered with Tag? GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser234-Ala435
Protein Accession O14763
Aliases /Synonyms Tumor necrosis factor receptor superfamily member 10B,Death receptor 5,TNF-related apoptosis-inducing ligand receptor 2,TRAIL receptor 2,TRAIL-R2,CD262.
Reference PX-P5189
Note For research use only
Molecular Constructor
Ser234–Ala435 GST
Product name PX-P5189-50
Uniprot ID O14763
Uniprot link https://www.uniprot.org/uniprot/O14763
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SLLWKKVLPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGVNMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRKLGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIEDHLLSSGKFMYLEGNA
Molecular weight 47.74 kDa
Protein delivered with Tag? GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser234-Ala435
Protein Accession O14763
Aliases /Synonyms Tumor necrosis factor receptor superfamily member 10B,Death receptor 5,TNF-related apoptosis-inducing ligand receptor 2,TRAIL receptor 2,TRAIL-R2,CD262.
Reference PX-P5189
Note For research use only
Molecular Constructor
Ser234–Ala435 GST

TNFRSF10B recombinant protein

There are no reviews yet.

Be the first to review “TNFRSF10B recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products