Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD62L recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P14151
Molecular weight:
52.82 kDa

Original price was: $292.00.Current price is: $230.00.

50ug 21% OFF + 230 loyalty points
Glu109–Ser346 N-GST
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD62L recombinant protein

Product name PX-P5195-100
Uniprot ID P14151
Uniprot link https://www.uniprot.org/uniprot/P14151
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence EEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFS
Molecular weight 52.82 kDa
Protein delivered with Tag? N-GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu109-Ser346
Protein Accession P14151
Aliases /Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1, CD62L, LYAM1, TQ1, SELL, Leukocyte-endothelial cell adhesion molecule 1, L-selectin, LAM-1, gp90-MEL, LNHR, LECAM1, Lymph node homing receptor, Leukocyte surface antigen Leu-8
Reference PX-P5195
Note For research use only
Molecular Constructor
Glu109–Ser346 N-GST
Product name PX-P5195-1MG
Uniprot ID P14151
Uniprot link https://www.uniprot.org/uniprot/P14151
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence EEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFS
Molecular weight 52.82 kDa
Protein delivered with Tag? N-GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu109-Ser346
Protein Accession P14151
Aliases /Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1, CD62L, LYAM1, TQ1, SELL, Leukocyte-endothelial cell adhesion molecule 1, L-selectin, LAM-1, gp90-MEL, LNHR, LECAM1, Lymph node homing receptor, Leukocyte surface antigen Leu-8
Reference PX-P5195
Note For research use only
Molecular Constructor
Glu109–Ser346 N-GST
Product name PX-P5195-50
Uniprot ID P14151
Uniprot link https://www.uniprot.org/uniprot/P14151
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence EEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFS
Molecular weight 52.82 kDa
Protein delivered with Tag? N-GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu109-Ser346
Protein Accession P14151
Aliases /Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1, CD62L, LYAM1, TQ1, SELL, Leukocyte-endothelial cell adhesion molecule 1, L-selectin, LAM-1, gp90-MEL, LNHR, LECAM1, Lymph node homing receptor, Leukocyte surface antigen Leu-8
Reference PX-P5195
Note For research use only
Molecular Constructor
Glu109–Ser346 N-GST

CD62L recombinant protein

There are no reviews yet.

Be the first to review “CD62L recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products