Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD62L/SELL Monoclonal Antibody

  • ARO-A15777-50
  • Validated ELISA FC

Original price was: $414.00.Current price is: $326.00.

50ug 21% OFF + 326 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD62L/SELL Monoclonal Antibody

Product name ARO-A15777-100
Uniprot ID P14151
Uniprot link P14151
Raw Antigen Sequence MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1, CD62L, LYAM1, TQ1, SELL, Leukocyte-endothelial cell adhesion molecule 1, L-selectin, LAM-1, gp90-MEL, LNHR, LECAM1, Lymph node homing receptor, Leukocyte surface antigen Leu-8
Reference ARO-A15777
Isotype IgG4
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD62L/SELL
Clone Name HuDreg-55
Protein Name CD62L/SELL
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15777-1MG
Uniprot ID P14151
Uniprot link P14151
Raw Antigen Sequence MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1, CD62L, LYAM1, TQ1, SELL, Leukocyte-endothelial cell adhesion molecule 1, L-selectin, LAM-1, gp90-MEL, LNHR, LECAM1, Lymph node homing receptor, Leukocyte surface antigen Leu-8
Reference ARO-A15777
Isotype IgG4
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD62L/SELL
Clone Name HuDreg-55
Protein Name CD62L/SELL
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15777-50
Uniprot ID P14151
Uniprot link P14151
Raw Antigen Sequence MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1, CD62L, LYAM1, TQ1, SELL, Leukocyte-endothelial cell adhesion molecule 1, L-selectin, LAM-1, gp90-MEL, LNHR, LECAM1, Lymph node homing receptor, Leukocyte surface antigen Leu-8
Reference ARO-A15777
Isotype IgG4
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD62L/SELL
Clone Name HuDreg-55
Protein Name CD62L/SELL
Target species Anti-Human Monoclonal Antibody

Human CD62L/SELL Monoclonal Antibody binds to CD62L recombinant protein in ELISA Assay

Human CD62L/SELL Monoclonal Antibody binds to CD62L recombinant protein in ELISA Assay

CD62L recombinant protein(cat. No.PX-P5195) at 0.5µg/mL (100µL/well) can bind Human CD62L/SELL Monoclonal Antibody in indirect ELISA with Goat secondary antibody measured by OD450.

Flow Cytometry results for Human CD62L/SELL Monoclonal Antibody

Flow Cytometry results for Human CD62L/SELL Monoclonal Antibody

Flow-cytometry using anti-human SELL antibody. Human Jurkat cell line were stained with an irrelevant antibody (Green Histogram) or an anti-human SELL antibody monoclonal antibody (Catalog # ARO-A15777 , Red Histogram) at a concentration of 20 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-human antibody (Catalog # PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Human CD62L/SELL Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD62L/SELL Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products