Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Aselizumab Biosimilar – Anti-SELL, CD62L mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4-nd

Original price was: $212.00.Current price is: $167.00.

50ug 21% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Aselizumab Biosimilar - Anti-SELL, CD62L mAb - Research Grade

Product name Aselizumab Biosimilar - Anti-SELL, CD62L mAb - Research Grade
Uniprot ID P14151
Source CAS 395639-53-9
Species Humanized
Raw Antigen Sequence MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Aselizumab,HuDreg-55,SELL, CD62L ,anti-SELL, CD62L
Reference PX-TA1194
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-nd
Clonality Monoclonal Antibody
Product name Aselizumab Biosimilar - Anti-SELL, CD62L mAb - Research Grade
Uniprot ID P14151
Source CAS 395639-53-9
Species Humanized
Raw Antigen Sequence MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Aselizumab,HuDreg-55,SELL, CD62L ,anti-SELL, CD62L
Reference PX-TA1194
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-nd
Clonality Monoclonal Antibody
Product name PX-TA1194-50
Uniprot ID P14151
Source CAS 395639-53-9
Species Humanized
Raw Antigen Sequence MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Aselizumab,HuDreg-55,SELL, CD62L ,anti-SELL, CD62L
Reference PX-TA1194
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-nd
Clonality Monoclonal Antibody

Introduction to Aselizumab Biosimilar – Anti-SELL, CD62L mAb – Research Grade Aselizumab Biosimilar is a monoclonal antibody (mAb) that targets the SELL protein, also known as CD62L. This protein is found on the surface of leukocytes, specifically on the surface of T cells and B cells. Aselizumab Biosimilar is a biosimilar version of the original Aselizumab, which has been approved for the treatment of multiple sclerosis in Japan. In this article, we will explore the structure, activity, and potential applications of Aselizumab Biosimilar as a therapeutic antibody.

Structure of Aselizumab Biosimilar

Aselizumab Biosimilar is a recombinant, humanized IgG1 monoclonal antibody. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region is responsible for binding to the SELL protein, while the constant region determines the effector function of the antibody.

The variable region of Aselizumab Biosimilar is designed to be highly specific for the SELL protein. This is achieved through the use of recombinant DNA technology, where the variable region is derived from a hybridoma cell line that produces the original Aselizumab. The constant region, on the other hand, is derived from human immunoglobulin sequences to minimize potential immunogenicity.

Mechanism of Action of Aselizumab Biosimilar

Aselizumab Biosimilar works by binding to the SELL protein on the surface of leukocytes. This binding prevents the interaction between SELL and its ligand, which is necessary for leukocytes to migrate from the blood into the tissues. As a result, the migration of leukocytes to sites of inflammation is inhibited, reducing the inflammatory response.

In addition, Aselizumab Biosimilar can also induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). This means that the antibody can recruit immune cells and complement proteins to target and destroy cells expressing the SELL protein, such as activated leukocytes.

Title: Potential Applications of Aselizumab Biosimilar

Aselizumab Biosimilar has shown promising results in preclinical studies for the treatment of various inflammatory and autoimmune diseases, such as multiple sclerosis, rheumatoid arthritis, and psoriasis. This is due to its ability to inhibit leukocyte migration and reduce inflammation.

In addition, Aselizumab Biosimilar has also been studied for its potential in preventing organ rejection in transplant patients. By inhibiting leukocyte migration, it can prevent the infiltration of immune cells into the transplanted organ, reducing the risk of rejection.

Conclusion

In conclusion, Aselizumab Biosimilar is a recombinant, humanized monoclonal antibody that targets the SELL protein on the surface of leukocytes. Its unique mechanism of action makes it a promising therapeutic option for various inflammatory and autoimmune diseases, as well as for preventing organ rejection in transplant patients. With further research and clinical trials, Aselizumab Biosimilar has the potential to provide effective treatment for these conditions.

SDS-PAGE for Aselizumab Biosimilar - Anti-CD62L;SELL mAb - Research Grade

SDS-PAGE for Aselizumab Biosimilar - Anti-CD62L;SELL mAb - Research Grade

Aselizumab Biosimilar - Anti-CD62L;SELL mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Aselizumab Biosimilar - Anti-SELL, CD62L  mAb - Research Grade

There are no reviews yet.

Be the first to review “Aselizumab Biosimilar – Anti-SELL, CD62L mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products