Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human TSG101 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q99816
Molecular weight:
17.44 kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human TSG101 Recombinant Protein

Human TSG101 Recombinant Protein

Product name Human TSG101 Recombinant Protein
Uniprot ID Q99816
Uniprot link http://www.uniprot.org/uniprot/Q99816
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Molecular weight 17.44 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference Q99816
Aliases /Synonyms TSG10, VPS23, Tumor Susceptibility Gene 10, ESCRT-I complex subunit TSG101,Tumor Susceptibility Gene 101
Reference PX-P3051
Note For research use only
Molecular Constructor
Partial Yes
Product name Human TSG101 Recombinant Protein
Uniprot ID Q99816
Uniprot link http://www.uniprot.org/uniprot/Q99816
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Molecular weight 17.44 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference Q99816
Aliases /Synonyms TSG10, VPS23, Tumor Susceptibility Gene 10, ESCRT-I complex subunit TSG101,Tumor Susceptibility Gene 101
Reference PX-P3051
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human TSG101 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products