Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Human MSH5Cter Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O43196
Molecular weight:
49,54 kDa

$250.00

+ 250 loyalty points
Partial Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human MSH5Cter Recombinant Protein

Product name Human MSH5Cter Recombinant Protein
Uniprot ID O43196
Uniprot link http://www.uniprot.org/uniprot/O43196
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLPRAPEIDEKKRRLMGLPSFLTEVARKELENLDSRIPSCSVIYIPLIGFLLSIPRLPSMVEASDFEINGL DFMFLSEEKLHYRSARTKELDALLGDLHCEIRDQETLLMYQLQCQVLARAAVLTRVLDLASRLDVLLALASAARDYGYSR PRYSPQVLGVRIQNGRHPLMELCARTFVPNSTECGGDKGRVKVITGPNSSGKSIYLKQVGLITFMALVGSFVPAEEAEIG AVDAIFTRIHSCESISLGLSTFMIDLNQQVAKAVNNATAQSLVLIDEFGKGTNTVDGLALLAAVLRHWLARGPTCPHIFV ATNFLSLVQLQLLPQGPLVQYLTMETCEDGNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEVSDLIRSGKPIK PVKDLLKKNQMENCQTLVDKFMKLDLEDPNLDLNVFMSQEVLPAATSIL
Molecular weight 49,54 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer NaH2PO4 100mM, TrisHCl 10mM, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_002432.1
Spec:Entrez GeneID 4439
Spec:NCBI Gene Aliases G7, NG23, MUTSH5
Spec:SwissProtID O43196
NCBI Reference NP_002432.1
Aliases /Synonyms MSH5Cter, mutS protein homolog 5 isoform c
Reference PX-P1126
Note For research use only
Molecular Constructor
Partial Yes
Product name Human MSH5Cter Recombinant Protein
Uniprot ID O43196
Uniprot link http://www.uniprot.org/uniprot/O43196
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLPRAPEIDEKKRRLMGLPSFLTEVARKELENLDSRIPSCSVIYIPLIGFLLSIPRLPSMVEASDFEINGL DFMFLSEEKLHYRSARTKELDALLGDLHCEIRDQETLLMYQLQCQVLARAAVLTRVLDLASRLDVLLALASAARDYGYSR PRYSPQVLGVRIQNGRHPLMELCARTFVPNSTECGGDKGRVKVITGPNSSGKSIYLKQVGLITFMALVGSFVPAEEAEIG AVDAIFTRIHSCESISLGLSTFMIDLNQQVAKAVNNATAQSLVLIDEFGKGTNTVDGLALLAAVLRHWLARGPTCPHIFV ATNFLSLVQLQLLPQGPLVQYLTMETCEDGNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEVSDLIRSGKPIK PVKDLLKKNQMENCQTLVDKFMKLDLEDPNLDLNVFMSQEVLPAATSIL
Molecular weight 49,54 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer NaH2PO4 100mM, TrisHCl 10mM, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_002432.1
Spec:Entrez GeneID 4439
Spec:NCBI Gene Aliases G7, NG23, MUTSH5
Spec:SwissProtID O43196
NCBI Reference NP_002432.1
Aliases /Synonyms MSH5Cter, mutS protein homolog 5 isoform c
Reference PX-P1126
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human MSH5Cter Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products