Brand: ProteoGenix

Anti-Human JUN Polyclonal Antibody

ARO-A12724-50
Validated WB

Clonality:: Polyclonal Antibody
Host species:: Rabbit

Original price was: $189.00.Current price is: $140.00.

50ug 26% OFF + 140 loyalty points

Size Size

50ug Original price was: $189.00.Current price is: $140.00.
100ug Original price was: $248.00.Current price is: $201.00.
1MG Original price was: $798.00.Current price is: $583.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human JUN Polyclonal Antibody

Product name	ARO-A12724-100
Uniprot ID	P05412
Raw Antigen Sequence	MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Buffer	0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-Proto-oncogene c-Jun, JUN, V-jun avian sarcoma virus 17 oncogene homolog, Transcription factor AP-1, AP1, Activator protein 1, p39
Reference	ARO-A12724
Clonality	Polyclonal Antibody
Protein Name	E. coli - derived recombinant Human JUN (Met1-Phe331).

Product name	ARO-A12724-1MG
Uniprot ID	P05412
Raw Antigen Sequence	MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Buffer	0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-Proto-oncogene c-Jun, JUN, V-jun avian sarcoma virus 17 oncogene homolog, Transcription factor AP-1, AP1, Activator protein 1, p39
Reference	ARO-A12724
Clonality	Polyclonal Antibody
Protein Name	E. coli - derived recombinant Human JUN (Met1-Phe331).

Product name	ARO-A12724-50
Uniprot ID	P05412
Raw Antigen Sequence	MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Buffer	0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-Proto-oncogene c-Jun, JUN, V-jun avian sarcoma virus 17 oncogene homolog, Transcription factor AP-1, AP1, Activator protein 1, p39
Reference	ARO-A12724
Clonality	Polyclonal Antibody
Protein Name	E. coli - derived recombinant Human JUN (Met1-Phe331).

Datasheet

Anti-Human JUN Polyclonal Antibody binds to c-JUN Protein - Transcription factor AP-1(JUN) in WB Assay

c-JUN Protein - Transcription factor AP-1(JUN)(cat. No.PX-P4739) can bind Anti-Human JUN Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-Human JUN Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-Human JUN Polyclonal Antibody

Anti-Human JUN Polyclonal Antibody

Anti-Human JUN Polyclonal Antibody binds to c-JUN Protein - Transcription factor AP-1(JUN) in WB Assay

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human JUN Polyclonal Antibody

Specifications Anti-Human JUN Polyclonal Antibody

Documents

QC & Validation

Anti-Human JUN Polyclonal Antibody binds to c-JUN Protein - Transcription factor AP-1(JUN) in WB Assay

Reviews

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human JUN Polyclonal Antibody