Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Proto-oncogene c-Fos(FOS)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P01100
Molecular weight:
41.7kDa

Original price was: $246.00.Current price is: $217.00.

50ug 12% OFF + 217 loyalty points
Met1–Leu380 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Proto-oncogene c-Fos(FOS)

Product name Proto-oncogene c-Fos(FOS)
Uniprot ID P01100
Uniprot link https://www.uniprot.org/uniprot/P01100
Expression system Prokaryotic expression
Raw Antigen Sequence MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Molecular weight 41.7kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS PH7.5, 0.02 %Sarcosyl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu380
Protein Accession P01100
Spec:Entrez GeneID 2353
Spec:NCBI Gene Aliases p55; AP-1; C-FOS
Spec:SwissProtID B4DQ65
NCBI Reference P01100
Aliases /Synonyms Cellular oncogene fos,G0/G1 switch regulatory protein 7,G0S7
Reference PX-P4762
Note For research use only
Molecular Constructor
Met1–Leu380 His
Product name Proto-oncogene c-Fos(FOS)
Uniprot ID P01100
Uniprot link https://www.uniprot.org/uniprot/P01100
Expression system Prokaryotic expression
Raw Antigen Sequence MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Molecular weight 41.7kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS PH7.5, 0.02 %Sarcosyl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu380
Protein Accession P01100
Spec:Entrez GeneID 2353
Spec:NCBI Gene Aliases p55; AP-1; C-FOS
Spec:SwissProtID B4DQ65
NCBI Reference P01100
Aliases /Synonyms Cellular oncogene fos,G0/G1 switch regulatory protein 7,G0S7
Reference PX-P4762
Note For research use only
Molecular Constructor
Met1–Leu380 His
Product name PX-P4762-1MG
Uniprot ID P01100
Uniprot link https://www.uniprot.org/uniprot/P01100
Expression system Prokaryotic expression
Raw Antigen Sequence MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Molecular weight 41.7kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS PH7.5, 0.02 %Sarcosyl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu380
Protein Accession P01100
Spec:Entrez GeneID 2353
Spec:NCBI Gene Aliases p55; AP-1; C-FOS
Spec:SwissProtID B4DQ65
NCBI Reference P01100
Aliases /Synonyms Cellular oncogene fos,G0/G1 switch regulatory protein 7,G0S7
Reference PX-P4762
Note For research use only
Molecular Constructor
Met1–Leu380 His

Proto-oncogene c-Fos(FOS)

There are no reviews yet.

Be the first to review “Proto-oncogene c-Fos(FOS)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products