Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD24 Recombinant Protein |
|---|---|
| Uniprot ID | P25063 |
| Uniprot link | http://www.uniprot.org/uniprot/P25063 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNTGLAPNPTNATTKAAG |
| Molecular weight | 47kDa |
| Protein delivered with Tag? | C-terminal Fc Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-Gly59 |
| Aliases /Synonyms | CD24A |
| Reference | PX-P4079 |
| Note | For research use only |
The cluster of differentiation system (CD) is commonly used as a cell marker for immunophenotyping. Different types of cells in the immune system can be identified by surface CD molecules related to cellular immune function. More than 32 unique CD groups and subcategories have been identified. Some CD molecules act as important receptors or ligands for cells, starting a signal cascade and then altering the cell’s behavior. Some CD proteins are not involved in the cell signaling process, but have other functions, such as cell incorporation. Differentiation scissors 24, also known as CD24 signal transducer or stable heatable antigen CD24 (HSA), is a glycoprotein that binds to the glycosylphosphatidylinositol type and binds to the mucin expressed on the surface of B cells, so differentiate into new cells and several tumors. It is involved in the molecular adhesion and spread of the metastatic tumor and acts as a normal receptor for P-selectin. In promoting interaction with platelets and endothelial cells, the CD24 / P selectin pathway may be important in the alienation of tumor cells. It is also considered a tumor marker. High levels of CD24 expression have been found in epithelial ovarian cancer, breast cancer, non-cellular lung cancer, prostate cancer and pancreatic cancer.
Related products
Send us a message from the form below
Reviews
There are no reviews yet.