Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | CD28 Recombinant Protein |
---|---|
Uniprot ID | P10747 |
Uniprot link | http://www.uniprot.org/uniprot/P10747 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP |
Molecular weight | 42.63KDa |
Protein delivered with Tag? | C-terminal Fc Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Met1~Pro152 |
Aliases /Synonyms | / |
Reference | PX-P4080 |
Note | For research use only |
CD28 (Cluster of Differentiation 28) belongs to the immunoglobulin (Ig) superfamily. It is a glycoprotein linked to dyslipidemia. It is structurally composed of a single Ig V-like extracellular domain, transmembrane domain and intracellular domain. Mouse CD28 is structurally expressed on the surface of all parietal cells and developing thymocytes in the form of disulfide-bound homodimers or monomers. CD28 can bind B7-1 and B7-2 ligands and together play an important role in the response of T lymphocytes and B lymphocytes and tolerance of peripheral cells. Thus, CD28 is involved in the activation of T cells, the induction of cell proliferation, the production of cytokines and the acceleration of T cell survival.
Send us a message from the form below
Reviews
There are no reviews yet.