Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
CD344 Recombinant Protein
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD344 Recombinant Protein |
|---|---|
| Uniprot ID | Q9ULV1 |
| Uniprot link | http://www.uniprot.org/uniprot/Q9ULV1 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MAWRGAGPSVPGAPGGVGLSLGLLLQLLLLLGPARGFGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE |
| Molecular weight | 22-28kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-Glu180 |
| Aliases /Synonyms | EVR1,FEVR,Fz-4,Fz4,FZD4S,FzE4,GPCR,hFz4 |
| Reference | PX-P4122 |
| Note | For research use only |
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.