Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD344 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9ULV1
Molecular weight:
22-28kDa

Original price was: $427.00.Current price is: $350.00.

50ug 18% OFF + 350 loyalty points
Met1–Glu180 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD344 Recombinant Protein

Product name PX-P4122-100
Uniprot ID Q9ULV1
Uniprot link http://www.uniprot.org/uniprot/Q9ULV1
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MAWRGAGPSVPGAPGGVGLSLGLLLQLLLLLGPARGFGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
Molecular weight 22-28kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Glu180
Aliases /Synonyms EVR1,FEVR,Fz-4,Fz4,FZD4S,FzE4,GPCR,hFz4
Reference PX-P4122
Note For research use only
Molecular Constructor
Met1–Glu180 His
Product name PX-P4122-1MG
Uniprot ID Q9ULV1
Uniprot link http://www.uniprot.org/uniprot/Q9ULV1
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MAWRGAGPSVPGAPGGVGLSLGLLLQLLLLLGPARGFGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
Molecular weight 22-28kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Glu180
Aliases /Synonyms EVR1,FEVR,Fz-4,Fz4,FZD4S,FzE4,GPCR,hFz4
Reference PX-P4122
Note For research use only
Molecular Constructor
Met1–Glu180 His
Product name PX-P4122-50
Uniprot ID Q9ULV1
Uniprot link http://www.uniprot.org/uniprot/Q9ULV1
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MAWRGAGPSVPGAPGGVGLSLGLLLQLLLLLGPARGFGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
Molecular weight 22-28kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Glu180
Aliases /Synonyms EVR1,FEVR,Fz-4,Fz4,FZD4S,FzE4,GPCR,hFz4
Reference PX-P4122
Note For research use only
Molecular Constructor
Met1–Glu180 His

CD344 Recombinant Protein

There are no reviews yet.

Be the first to review “CD344 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products