Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now

Clostridium chauvoei CCTA-His Recombinant Protein

Reference:
Size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameClostridium chauvoei CCTA-His Recombinant Protein
Uniprot IDI6VBE8
Uniprot linkhttp://www.uniprot.org/uniprot/I6VBE8
Origin speciesClostridium chauvoei
Expression systemProkaryotic expression
SequenceMNHKVHHHHHHMQENTCIVETPSEGVKTFTSSDTAYADYNCFKTNLSVTFIEDQHNNQLT ALVSTEGSFIPSGLSRVGGYYQADMYWPSKYYTTLTTYDRNNRVKITKSIPTNQIDTVSV SETMGYSIGGSLSIEYGKEGPKAGGGINGSYTAQRSVTYDQPDYRTLLMKDSVNSASWEV AFNATKDGYDRDSYHGIYGNQLFMRYRLYNTGINNLTTDNNLSSLIVGGFSPKVVIALTA PKGTEESTVKVEYNRFNDQYRLRWSGTEWYGENNRNSRIDSSSESFILNWKNHTVEHAGY
Molecular weight33.9kDa
Protein delivered with Tag?His
Purity estimated90%
BufferPBS pH 7.5, 4 M urea
Delivery conditionDry Ice
Delivery lead time in business days5-7
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-47% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionCDG01028
Spec:SwissProtIDS6F7P4
NCBI ReferenceCDG01028
ReferencePX-P4067
NoteFor research use only

Description of Clostridium chauvoei CCTA-His Recombinant Protein

About CCTA: a secreted toxin

CCTA ( Clostridium chauvoei Toxin A) is an exotoxin from the Beta-barrel family of pore and is part of the leucocidin toxin superfamily. It is a α-hemolysin secreted by C. chauvoei ) (anaerobic gram positive bacillus, which is transmitted by spores) and also is a major factor of virulence of a soil borne zoonose: the blackleg disease in humans and domestic animals, especially ruminants. It produces cytolysis in tissues, hemolysis in the erythrocytes, oedemic lesions, and necrosis of the skin and a release of cytokines which is causing inflammation shock. Blackleg disease is controlled by vaccines composed of the whole inactivated bacteria. But it appears that the protective immunity may be linked to CCTA, as it is a protective antigen against muscular gas gangrene among humans.

A product for your experiences

CCTA-His recombinant protein is designed to be extracted and purified the easiest way from cell lysates. This exotoxin is fused with the N-terminal His Tag and is expressed in E. coli. This recombinant product could be used in research about immunity and to highlight some mechanism of actions.
Proteogenix offers this recombinant product to help research in immunology and toxicology. It can also be used to improve the knowledge about the leucocidin toxin superfamily. Research used only.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Clostridium chauvoei CCTA-His Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Send us a message from the form below

    Cart (0 Items)

    Your cart is currently empty.

    View Products