Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Clostridium chauvoei CCTA-His Recombinant Protein |
|---|---|
| Uniprot ID | I6VBE8 |
| Uniprot link | http://www.uniprot.org/uniprot/I6VBE8 |
| Origin species | Clostridium chauvoei |
| Expression system | Prokaryotic expression |
| Sequence | MNHKVHHHHHHMQENTCIVETPSEGVKTFTSSDTAYADYNCFKTNLSVTFIEDQHNNQLT ALVSTEGSFIPSGLSRVGGYYQADMYWPSKYYTTLTTYDRNNRVKITKSIPTNQIDTVSV SETMGYSIGGSLSIEYGKEGPKAGGGINGSYTAQRSVTYDQPDYRTLLMKDSVNSASWEV AFNATKDGYDRDSYHGIYGNQLFMRYRLYNTGINNLTTDNNLSSLIVGGFSPKVVIALTA PKGTEESTVKVEYNRFNDQYRLRWSGTEWYGENNRNSRIDSSSESFILNWKNHTVEHAGY |
| Molecular weight | 33.9kDa |
| Protein delivered with Tag? | His |
| Purity estimated | 90% |
| Buffer | PBS pH 7.5, 4 M urea |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-47% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | CDG01028 |
| Spec:SwissProtID | S6F7P4 |
| NCBI Reference | CDG01028 |
| Reference | PX-P4067 |
| Note | For research use only |
CCTA ( Clostridium chauvoei Toxin A) is an exotoxin from the Beta-barrel family of pore and is part of the leucocidin toxin superfamily. It is a α-hemolysin secreted by C. chauvoei ) (anaerobic gram positive bacillus, which is transmitted by spores) and also is a major factor of virulence of a soil borne zoonose: the blackleg disease in humans and domestic animals, especially ruminants. It produces cytolysis in tissues, hemolysis in the erythrocytes, oedemic lesions, and necrosis of the skin and a release of cytokines which is causing inflammation shock. Blackleg disease is controlled by vaccines composed of the whole inactivated bacteria. But it appears that the protective immunity may be linked to CCTA, as it is a protective antigen against muscular gas gangrene among humans.
CCTA-His recombinant protein is designed to be extracted and purified the easiest way from cell lysates. This exotoxin is fused with the N-terminal His Tag and is expressed in E. coli. This recombinant product could be used in research about immunity and to highlight some mechanism of actions.
Proteogenix offers this recombinant product to help research in immunology and toxicology. It can also be used to improve the knowledge about the leucocidin toxin superfamily. Research used only.
Send us a message from the form below
Reviews
There are no reviews yet.