Clostridium Cwp84 Recombinant Protein

Reference:
Size

100ug, 50ug

Brand

Product type

Host Species

Applications

,

Product nameClostridium Cwp84 Recombinant Protein
Uniprot IDQ183M1
Uniprot linkhttp://www.uniprot.org/uniprot/Q183M1
Origin speciesClostridium
Expression systemProkaryotic expression
SequenceMGSSHHHHHHSSGLVPRGSHMASAENHKTLDGVETAEYSESYLQYLEDVKNGDTAKYNGVIPFPHEMEGTTLRNKGRSSL PSAYKSSVAYNPMDLGLTTPAKNQGSLNTCWSFSGMSTLEAYLKLKGYGTYDLSEEHLRWWATGGKYGWNLDDMSGSSNV TAIGYLTAWAGPKLEKDIPYNLKSEAQGATKPSNMDTAPTQFNVTDVVRLNKDKETVKNAIMQYGSVTSGYAHYSTYFNK DETAYNCTNKRAPLNHAVAIVGWDDNYSKDNFASDVKPESNGAWLVKSSWGEFNSMKGFFWISYEDKTLLTDTDNYAMKS VSKPDSDKKMYQLEYAGLSKIMSNKVTAANVFDFSRDSEKLDSVMFETDSVGAKYEVYYAPVVNGVPQNNSMTKLASGTV SYSGYINVPTNSYSLPKGKGAIVVVIDNTANPNREKSTLAYETNIDAYYLYEAKANLGESYILQNNKFEDINTYSEFSPC NFVIKAITKTSSGQATSGESLTGADRYETAVKVSQKGWTSSQNAVLVNGDAIVDALTATPFTAAIDSPILLTGKDNLDSK TKAELQRLGTKKVYLIGGENSLSKNVQTQLSNMGISVERISGSDRYKTSISLAQKLNSIKSVSQVAVANGVNGLADAISV GAAAADNNMPIILTNEKSELQGADEFLNSSKITKSYIIGGTATLSSNLESKLSNPTRLAGSNRNETNAKIIDKFYPSSDL KYAFVVKDGSKSQGDLIDGLAVGALGAKTDSPVVLVGNKLDESQKNVLKSKKIETPIRVGGNGNESAFNELNTLLGK
Molecular weight83,36 kDa
Protein delivered with Tag?Yes
Purity estimated60%
BufferPBS, imidazole 300mM
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
ApplicationsELISA,WB
Fragment TypePartial
Protein AccessionYP_001089300.1
Spec:Entrez GeneID4915160
Spec:SwissProtIDQ183M1
NCBI ReferenceYP_001089300.1
Aliases /SynonymsCwp84, cell surface-associated cysteine protease, CD630_27870
ReferencePX-P1083
NoteFor research use only

Description of Clostridium Cwp84 Recombinant Protein

General information on Clostridium Cwp84 Recombinant Protein:

Cwp84 is a Clostridium. difficile surface protein that has recently been shown to possess cysteine protease activity and which is highly immunogenic in patients with C. difficile-associated disease and is likely implicated in the pathogenic process and may have a role in the degradation of extracellular matrices. This enzyme, which appears to be displayed on the bacterial cell surface, exhibited degrading activity against fibronectin, laminin, and vitronectin. Cwp84 plays also a role in maturation of SlpA.

Publication

  • 1: Bradshaw WJ, Roberts AK, Shone CC, Acharya KR. Cwp84, a Clostridium difficile cysteine protease, exhibits conformational flexibility in the absence of its propeptide. Acta Crystallogr F Struct Biol Commun. 2015 Mar;71(Pt 3):295-303. doi: 10.1107/S2053230X15001065. Epub 2015 Feb 19. PubMed PMID: 25760704; PubMed Central PMCID: PMC4356305.
  • 2: ChapetónMontes D, Candela T, Collignon A, Janoir C. Localization of the Clostridium difficile cysteine protease Cwp84 and insights into its maturation process. J Bacteriol. 2011 Oct;193(19):5314-21. doi: 10.1128/JB.00326-11. Epub 2011 Jul 22. PubMed PMID: 21784932; PubMed Central PMCID: PMC3187449.
  • 3: de la Riva L, Willing SE, Tate EW, Fairweather NF. Roles of cysteine proteases Cwp84 and Cwp13 in biogenesis of the cell wall of Clostridium difficile. J Bacteriol. 2011 Jul;193(13):3276-85. doi: 10.1128/JB.00248-11. Epub 2011 Apr 29. PubMed PMID: 21531808; PubMed Central PMCID: PMC3133288.
  • 4: Pantaléon V, Soavelomandroso AP, Bouttier S, Briandet R, Roxas B, Chu M, Collignon A, Janoir C, Vedantam G, Candela T. The Clostridium difficile Protease Cwp84 Modulates both Biofilm Formation and Cell-Surface Properties. PLoS One. 2015 Apr 29;10(4):e0124971. doi: 10.1371/journal.pone.0124971. eCollection 2015. PubMed PMID: 25922949; PubMed Central PMCID: PMC4414356.
  • 5: Dannheim H, Riedel T, Neumann-Schaal M, Bunk B, Schober I, Spröer C, Chibani CM, Gronow S, Liesegang H, Overmann J, Schomburg D. Manual curation and reannotation of the genomes of Clostridium difficile 630Δerm and C. difficile 630. J Med Microbiol. 2017 Mar;66(3):286-293. doi: 10.1099/jmm.0.000427. PubMed PMID: 28357980.
  • 6: Monot M, Boursaux-Eude C, Thibonnier M, Vallenet D, Moszer I, Medigue C, Martin-Verstraete I, Dupuy B. Reannotation of the genome sequence of Clostridium difficile strain 630. J Med Microbiol. 2011 Aug;60(Pt 8):1193-9. doi: 10.1099/jmm.0.030452-0. Epub 2011 Feb 24. PubMed PMID: 21349987.
  • 7: Sebaihia M, Wren BW, Mullany P, Fairweather NF, Minton N, Stabler R, Thomson NR, Roberts AP, Cerdeño-Tárraga AM, Wang H, Holden MT, Wright A, Churcher C, Quail MA, Baker S, Bason N, Brooks K, Chillingworth T, Cronin A, Davis P, Dowd L, Fraser A, Feltwell T, Hance Z, Holroyd S, Jagels K, Moule S, Mungall K, Price C, Rabbinowitsch E, Sharp S, Simmonds M, Stevens K, Unwin L, Whithead S, Dupuy B, Dougan G, Barrell B, Parkhill J. The multidrug-resistant human pathogen Clostridium difficile has a highly mobile, mosaic genome. Nat Genet. 2006 Jul;38(7):779-86. Epub 2006 Jun 25. PubMed PMID: 16804543.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Clostridium Cwp84 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Send us a message from the form below







    Cart (0 Items)

    Your cart is currently empty.

    View Products