Skip to main content
Contact +1 (919) 234-1277

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Nycodenz AG® Nycodenz AG® XtenCHO ™ Race Starter kit XtenCHO ™ Race Starter kit
View all Products

Clostridium Cwp84 Recombinant Protein

Reference:
size

100ug, 50ug
Brand

ProteoGenix
Product type

Recombinant Proteins
Host Species

Escherichia coli (E. coli)
Applications

Elisa, WB
Specification
Description
Documents
Publications
Reviews
Product nameClostridium Cwp84 Recombinant Protein
Uniprot IDQ183M1
Uniprot linkhttp://www.uniprot.org/uniprot/Q183M1
Origin speciesClostridium
Expression systemProkaryotic expression
SequenceMGSSHHHHHHSSGLVPRGSHMASAENHKTLDGVETAEYSESYLQYLEDVKNGDTAKYNGVIPFPHEMEGTTLRNKGRSSL PSAYKSSVAYNPMDLGLTTPAKNQGSLNTCWSFSGMSTLEAYLKLKGYGTYDLSEEHLRWWATGGKYGWNLDDMSGSSNV TAIGYLTAWAGPKLEKDIPYNLKSEAQGATKPSNMDTAPTQFNVTDVVRLNKDKETVKNAIMQYGSVTSGYAHYSTYFNK DETAYNCTNKRAPLNHAVAIVGWDDNYSKDNFASDVKPESNGAWLVKSSWGEFNSMKGFFWISYEDKTLLTDTDNYAMKS VSKPDSDKKMYQLEYAGLSKIMSNKVTAANVFDFSRDSEKLDSVMFETDSVGAKYEVYYAPVVNGVPQNNSMTKLASGTV SYSGYINVPTNSYSLPKGKGAIVVVIDNTANPNREKSTLAYETNIDAYYLYEAKANLGESYILQNNKFEDINTYSEFSPC NFVIKAITKTSSGQATSGESLTGADRYETAVKVSQKGWTSSQNAVLVNGDAIVDALTATPFTAAIDSPILLTGKDNLDSK TKAELQRLGTKKVYLIGGENSLSKNVQTQLSNMGISVERISGSDRYKTSISLAQKLNSIKSVSQVAVANGVNGLADAISV GAAAADNNMPIILTNEKSELQGADEFLNSSKITKSYIIGGTATLSSNLESKLSNPTRLAGSNRNETNAKIIDKFYPSSDL KYAFVVKDGSKSQGDLIDGLAVGALGAKTDSPVVLVGNKLDESQKNVLKSKKIETPIRVGGNGNESAFNELNTLLGK
Molecular weight83,36 kDa
Protein delivered with Tag?Yes
Purity estimated60%
BufferPBS, imidazole 300mM
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionYP_001089300.1
Spec:Entrez GeneID4915160
Spec:SwissProtIDQ183M1
NCBI ReferenceYP_001089300.1
Aliases /SynonymsCwp84, cell surface-associated cysteine protease, CD630_27870
ReferencePX-P1083
NoteFor research use only

Description of Clostridium Cwp84 Recombinant Protein

General information on Clostridium Cwp84 Recombinant Protein:

Cwp84 is a Clostridium. difficile surface protein that has recently been shown to possess cysteine protease activity and which is highly immunogenic in patients with C. difficile-associated disease and is likely implicated in the pathogenic process and may have a role in the degradation of extracellular matrices. This enzyme, which appears to be displayed on the bacterial cell surface, exhibited degrading activity against fibronectin, laminin, and vitronectin. Cwp84 plays also a role in maturation of SlpA.

Datasheet Download
MSDS Download

Publication

  • 1: Bradshaw WJ, Roberts AK, Shone CC, Acharya KR. Cwp84, a Clostridium difficile _x000D_ cysteine protease, exhibits conformational flexibility in the absence of its_x000D_ propeptide. Acta Crystallogr F Struct Biol Commun. 2015 Mar;71(Pt 3):295-303._x000D_ doi: 10.1107/S2053230X15001065. Epub 2015 Feb 19. PubMed PMID: 25760704; PubMed_x000D_ Central PMCID: PMC4356305.
    • _x000D_ _x000D_ _x000D_
  • 2: ChapetónMontes D, Candela T, Collignon A, Janoir C. Localization of the_x000D_ Clostridium difficile cysteine protease Cwp84 and insights into its maturation_x000D_ process. J Bacteriol. 2011 Oct;193(19):5314-21. doi: 10.1128/JB.00326-11. Epub_x000D_ 2011 Jul 22. PubMed PMID: 21784932; PubMed Central PMCID: PMC3187449.
    • _x000D_ _x000D_ _x000D_
  • 3: de la Riva L, Willing SE, Tate EW, Fairweather NF. Roles of cysteine proteases_x000D_ Cwp84 and Cwp13 in biogenesis of the cell wall of Clostridium difficile. J_x000D_ Bacteriol. 2011 Jul;193(13):3276-85. doi: 10.1128/JB.00248-11. Epub 2011 Apr 29. _x000D_ PubMed PMID: 21531808; PubMed Central PMCID: PMC3133288.
    • _x000D_ _x000D_ _x000D_
  • 4: Pantaléon V, Soavelomandroso AP, Bouttier S, Briandet R, Roxas B, Chu M,_x000D_ Collignon A, Janoir C, Vedantam G, Candela T. The Clostridium difficile Protease _x000D_ Cwp84 Modulates both Biofilm Formation and Cell-Surface Properties. PLoS One._x000D_ 2015 Apr 29;10(4):e0124971. doi: 10.1371/journal.pone.0124971. eCollection 2015. _x000D_ PubMed PMID: 25922949; PubMed Central PMCID: PMC4414356.
    • _x000D_ _x000D_ _x000D_
  • 5: Dannheim H, Riedel T, Neumann-Schaal M, Bunk B, Schober I, Spröer C, Chibani_x000D_ CM, Gronow S, Liesegang H, Overmann J, Schomburg D. Manual curation and_x000D_ reannotation of the genomes of Clostridium difficile 630Δerm and C. difficile_x000D_ 630. J Med Microbiol. 2017 Mar;66(3):286-293. doi: 10.1099/jmm.0.000427. PubMed_x000D_ PMID: 28357980.
    • _x000D_ _x000D_ _x000D_
  • 6: Monot M, Boursaux-Eude C, Thibonnier M, Vallenet D, Moszer I, Medigue C,_x000D_ Martin-Verstraete I, Dupuy B. Reannotation of the genome sequence of Clostridium _x000D_ difficile strain 630. J Med Microbiol. 2011 Aug;60(Pt 8):1193-9. doi:_x000D_ 10.1099/jmm.0.030452-0. Epub 2011 Feb 24. PubMed PMID: 21349987.
    • _x000D_ _x000D_ _x000D_
  • 7: Sebaihia M, Wren BW, Mullany P, Fairweather NF, Minton N, Stabler R, Thomson_x000D_ NR, Roberts AP, Cerdeño-Tárraga AM, Wang H, Holden MT, Wright A, Churcher C,_x000D_ Quail MA, Baker S, Bason N, Brooks K, Chillingworth T, Cronin A, Davis P, Dowd L,_x000D_ Fraser A, Feltwell T, Hance Z, Holroyd S, Jagels K, Moule S, Mungall K, Price C, _x000D_ Rabbinowitsch E, Sharp S, Simmonds M, Stevens K, Unwin L, Whithead S, Dupuy B,_x000D_ Dougan G, Barrell B, Parkhill J. The multidrug-resistant human pathogen_x000D_ Clostridium difficile has a highly mobile, mosaic genome. Nat Genet. 2006_x000D_ Jul;38(7):779-86. Epub 2006 Jun 25. PubMed PMID: 16804543.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Clostridium Cwp84 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Send us a message from the form below

    Cart (0 Items)

    Your cart is currently empty.

    View Products