Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Clostridium Cwp84 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Clostridium
Uniprot ID:
Q183M1
Molecular weight:
83,36 kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Clostridium Cwp84 Recombinant Protein

Product name Clostridium Cwp84 Recombinant Protein
Uniprot ID Q183M1
Uniprot link http://www.uniprot.org/uniprot/Q183M1
Origin species Clostridium
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMASAENHKTLDGVETAEYSESYLQYLEDVKNGDTAKYNGVIPFPHEMEGTTLRNKGRSSL PSAYKSSVAYNPMDLGLTTPAKNQGSLNTCWSFSGMSTLEAYLKLKGYGTYDLSEEHLRWWATGGKYGWNLDDMSGSSNV TAIGYLTAWAGPKLEKDIPYNLKSEAQGATKPSNMDTAPTQFNVTDVVRLNKDKETVKNAIMQYGSVTSGYAHYSTYFNK DETAYNCTNKRAPLNHAVAIVGWDDNYSKDNFASDVKPESNGAWLVKSSWGEFNSMKGFFWISYEDKTLLTDTDNYAMKS VSKPDSDKKMYQLEYAGLSKIMSNKVTAANVFDFSRDSEKLDSVMFETDSVGAKYEVYYAPVVNGVPQNNSMTKLASGTV SYSGYINVPTNSYSLPKGKGAIVVVIDNTANPNREKSTLAYETNIDAYYLYEAKANLGESYILQNNKFEDINTYSEFSPC NFVIKAITKTSSGQATSGESLTGADRYETAVKVSQKGWTSSQNAVLVNGDAIVDALTATPFTAAIDSPILLTGKDNLDSK TKAELQRLGTKKVYLIGGENSLSKNVQTQLSNMGISVERISGSDRYKTSISLAQKLNSIKSVSQVAVANGVNGLADAISV GAAAADNNMPIILTNEKSELQGADEFLNSSKITKSYIIGGTATLSSNLESKLSNPTRLAGSNRNETNAKIIDKFYPSSDL KYAFVVKDGSKSQGDLIDGLAVGALGAKTDSPVVLVGNKLDESQKNVLKSKKIETPIRVGGNGNESAFNELNTLLGK
Molecular weight 83,36 kDa
Protein delivered with Tag? Yes
Purity estimated 60%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession YP_001089300.1
Spec:Entrez GeneID 4915160
Spec:SwissProtID Q183M1
NCBI Reference YP_001089300.1
Aliases /Synonyms Cwp84, cell surface-associated cysteine protease, CD630_27870
Reference PX-P1083
Note For research use only
Molecular Constructor
Partial Yes
Product name Clostridium Cwp84 Recombinant Protein
Uniprot ID Q183M1
Uniprot link http://www.uniprot.org/uniprot/Q183M1
Origin species Clostridium
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMASAENHKTLDGVETAEYSESYLQYLEDVKNGDTAKYNGVIPFPHEMEGTTLRNKGRSSL PSAYKSSVAYNPMDLGLTTPAKNQGSLNTCWSFSGMSTLEAYLKLKGYGTYDLSEEHLRWWATGGKYGWNLDDMSGSSNV TAIGYLTAWAGPKLEKDIPYNLKSEAQGATKPSNMDTAPTQFNVTDVVRLNKDKETVKNAIMQYGSVTSGYAHYSTYFNK DETAYNCTNKRAPLNHAVAIVGWDDNYSKDNFASDVKPESNGAWLVKSSWGEFNSMKGFFWISYEDKTLLTDTDNYAMKS VSKPDSDKKMYQLEYAGLSKIMSNKVTAANVFDFSRDSEKLDSVMFETDSVGAKYEVYYAPVVNGVPQNNSMTKLASGTV SYSGYINVPTNSYSLPKGKGAIVVVIDNTANPNREKSTLAYETNIDAYYLYEAKANLGESYILQNNKFEDINTYSEFSPC NFVIKAITKTSSGQATSGESLTGADRYETAVKVSQKGWTSSQNAVLVNGDAIVDALTATPFTAAIDSPILLTGKDNLDSK TKAELQRLGTKKVYLIGGENSLSKNVQTQLSNMGISVERISGSDRYKTSISLAQKLNSIKSVSQVAVANGVNGLADAISV GAAAADNNMPIILTNEKSELQGADEFLNSSKITKSYIIGGTATLSSNLESKLSNPTRLAGSNRNETNAKIIDKFYPSSDL KYAFVVKDGSKSQGDLIDGLAVGALGAKTDSPVVLVGNKLDESQKNVLKSKKIETPIRVGGNGNESAFNELNTLLGK
Molecular weight 83,36 kDa
Protein delivered with Tag? Yes
Purity estimated 60%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession YP_001089300.1
Spec:Entrez GeneID 4915160
Spec:SwissProtID Q183M1
NCBI Reference YP_001089300.1
Aliases /Synonyms Cwp84, cell surface-associated cysteine protease, CD630_27870
Reference PX-P1083
Note For research use only
Molecular Constructor
Partial Yes

General information on Clostridium Cwp84 Recombinant Protein:

Cwp84 is a Clostridium. difficile surface protein that has recently been shown to possess cysteine protease activity and which is highly immunogenic in patients with C. difficile-associated disease and is likely implicated in the pathogenic process and may have a role in the degradation of extracellular matrices. This enzyme, which appears to be displayed on the bacterial cell surface, exhibited degrading activity against fibronectin, laminin, and vitronectin. Cwp84 plays also a role in maturation of SlpA.

  • Bradshaw WJ, Roberts AK, Shone CC, Acharya KR. Cwp84, a Clostridium difficile cysteine protease, exhibits conformational flexibility in the absence of its propeptide. Acta Crystallogr F Struct Biol Commun. 2015 Mar;71(Pt 3):295-303. doi: 10.1107/S2053230X15001065. Epub 2015 Feb 19. PubMed PMID: 25760704; PubMed Central PMCID: PMC4356305.
  • ChapetónMontes D, Candela T, Collignon A, Janoir C. Localization of the Clostridium difficile cysteine protease Cwp84 and insights into its maturation process. J Bacteriol. 2011 Oct;193(19):5314-21. doi: 10.1128/JB.00326-11. Epub 2011 Jul 22. PubMed PMID: 21784932; PubMed Central PMCID: PMC3187449.
  • de la Riva L, Willing SE, Tate EW, Fairweather NF. Roles of cysteine proteases Cwp84 and Cwp13 in biogenesis of the cell wall of Clostridium difficile. J Bacteriol. 2011 Jul;193(13):3276-85. doi: 10.1128/JB.00248-11. Epub 2011 Apr 29. PubMed PMID: 21531808; PubMed Central PMCID: PMC3133288.
  • Pantaléon V, Soavelomandroso AP, Bouttier S, Briandet R, Roxas B, Chu M, Collignon A, Janoir C, Vedantam G, Candela T. The Clostridium difficile Protease Cwp84 Modulates both Biofilm Formation and Cell-Surface Properties. PLoS One. 2015 Apr 29;10(4):e0124971. doi: 10.1371/journal.pone.0124971. eCollection 2015. PubMed PMID: 25922949; PubMed Central PMCID: PMC4414356.
  • Dannheim H, Riedel T, Neumann-Schaal M, Bunk B, Schober I, Spröer C, Chibani CM, Gronow S, Liesegang H, Overmann J, Schomburg D. Manual curation and reannotation of the genomes of Clostridium difficile 630Δerm and C. difficile 630. J Med Microbiol. 2017 Mar;66(3):286-293. doi: 10.1099/jmm.0.000427. PubMed PMID: 28357980.
  • Monot M, Boursaux-Eude C, Thibonnier M, Vallenet D, Moszer I, Medigue C, Martin-Verstraete I, Dupuy B. Reannotation of the genome sequence of Clostridium difficile strain 630. J Med Microbiol. 2011 Aug;60(Pt 8):1193-9. doi: 10.1099/jmm.0.030452-0. Epub 2011 Feb 24. PubMed PMID: 21349987.
  • Sebaihia M, Wren BW, Mullany P, Fairweather NF, Minton N, Stabler R, Thomson NR, Roberts AP, Cerdeño-Tárraga AM, Wang H, Holden MT, Wright A, Churcher C, Quail MA, Baker S, Bason N, Brooks K, Chillingworth T, Cronin A, Davis P, Dowd L, Fraser A, Feltwell T, Hance Z, Holroyd S, Jagels K, Moule S, Mungall K, Price C, Rabbinowitsch E, Sharp S, Simmonds M, Stevens K, Unwin L, Whithead S, Dupuy B, Dougan G, Barrell B, Parkhill J. The multidrug-resistant human pathogen Clostridium difficile has a highly mobile, mosaic genome. Nat Genet. 2006 Jul;38(7):779-86. Epub 2006 Jun 25. PubMed PMID: 16804543.

There are no reviews yet.

Be the first to review “Clostridium Cwp84 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products