Brand: ProteoGenix

Clostridium Cwp84 Recombinant Protein

Host species:: Escherichia coli (E.coli)
Origin species:: Clostridium
Uniprot ID:: Q183M1
Molecular weight:: 83,36 kDa

$250.00

50ug + 250 loyalty points

Partial Yes

size size

50ug $250.00
100ug $1,108.00

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Clostridium Cwp84 Recombinant Protein

Product name	Clostridium Cwp84 Recombinant Protein
Uniprot ID	Q183M1
Uniprot link	http://www.uniprot.org/uniprot/Q183M1
Origin species	Clostridium
Expression system	Prokaryotic expression
Sequence	MGSSHHHHHHSSGLVPRGSHMASAENHKTLDGVETAEYSESYLQYLEDVKNGDTAKYNGVIPFPHEMEGTTLRNKGRSSL PSAYKSSVAYNPMDLGLTTPAKNQGSLNTCWSFSGMSTLEAYLKLKGYGTYDLSEEHLRWWATGGKYGWNLDDMSGSSNV TAIGYLTAWAGPKLEKDIPYNLKSEAQGATKPSNMDTAPTQFNVTDVVRLNKDKETVKNAIMQYGSVTSGYAHYSTYFNK DETAYNCTNKRAPLNHAVAIVGWDDNYSKDNFASDVKPESNGAWLVKSSWGEFNSMKGFFWISYEDKTLLTDTDNYAMKS VSKPDSDKKMYQLEYAGLSKIMSNKVTAANVFDFSRDSEKLDSVMFETDSVGAKYEVYYAPVVNGVPQNNSMTKLASGTV SYSGYINVPTNSYSLPKGKGAIVVVIDNTANPNREKSTLAYETNIDAYYLYEAKANLGESYILQNNKFEDINTYSEFSPC NFVIKAITKTSSGQATSGESLTGADRYETAVKVSQKGWTSSQNAVLVNGDAIVDALTATPFTAAIDSPILLTGKDNLDSK TKAELQRLGTKKVYLIGGENSLSKNVQTQLSNMGISVERISGSDRYKTSISLAQKLNSIKSVSQVAVANGVNGLADAISV GAAAADNNMPIILTNEKSELQGADEFLNSSKITKSYIIGGTATLSSNLESKLSNPTRLAGSNRNETNAKIIDKFYPSSDL KYAFVVKDGSKSQGDLIDGLAVGALGAKTDSPVVLVGNKLDESQKNVLKSKKIETPIRVGGNGNESAFNELNTLLGK
Molecular weight	83,36 kDa
Protein delivered with Tag?	Yes
Purity estimated	60%
Buffer	PBS, imidazole 300mM
Form	liquid
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Protein Accession	YP_001089300.1
Spec:Entrez GeneID	4915160
Spec:SwissProtID	Q183M1
NCBI Reference	YP_001089300.1
Aliases /Synonyms	Cwp84, cell surface-associated cysteine protease, CD630_27870
Reference	PX-P1083
Note	For research use only
Molecular Constructor	Partial Yes

Product name	Clostridium Cwp84 Recombinant Protein
Uniprot ID	Q183M1
Uniprot link	http://www.uniprot.org/uniprot/Q183M1
Origin species	Clostridium
Expression system	Prokaryotic expression
Sequence	MGSSHHHHHHSSGLVPRGSHMASAENHKTLDGVETAEYSESYLQYLEDVKNGDTAKYNGVIPFPHEMEGTTLRNKGRSSL PSAYKSSVAYNPMDLGLTTPAKNQGSLNTCWSFSGMSTLEAYLKLKGYGTYDLSEEHLRWWATGGKYGWNLDDMSGSSNV TAIGYLTAWAGPKLEKDIPYNLKSEAQGATKPSNMDTAPTQFNVTDVVRLNKDKETVKNAIMQYGSVTSGYAHYSTYFNK DETAYNCTNKRAPLNHAVAIVGWDDNYSKDNFASDVKPESNGAWLVKSSWGEFNSMKGFFWISYEDKTLLTDTDNYAMKS VSKPDSDKKMYQLEYAGLSKIMSNKVTAANVFDFSRDSEKLDSVMFETDSVGAKYEVYYAPVVNGVPQNNSMTKLASGTV SYSGYINVPTNSYSLPKGKGAIVVVIDNTANPNREKSTLAYETNIDAYYLYEAKANLGESYILQNNKFEDINTYSEFSPC NFVIKAITKTSSGQATSGESLTGADRYETAVKVSQKGWTSSQNAVLVNGDAIVDALTATPFTAAIDSPILLTGKDNLDSK TKAELQRLGTKKVYLIGGENSLSKNVQTQLSNMGISVERISGSDRYKTSISLAQKLNSIKSVSQVAVANGVNGLADAISV GAAAADNNMPIILTNEKSELQGADEFLNSSKITKSYIIGGTATLSSNLESKLSNPTRLAGSNRNETNAKIIDKFYPSSDL KYAFVVKDGSKSQGDLIDGLAVGALGAKTDSPVVLVGNKLDESQKNVLKSKKIETPIRVGGNGNESAFNELNTLLGK
Molecular weight	83,36 kDa
Protein delivered with Tag?	Yes
Purity estimated	60%
Buffer	PBS, imidazole 300mM
Form	liquid
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Protein Accession	YP_001089300.1
Spec:Entrez GeneID	4915160
Spec:SwissProtID	Q183M1
NCBI Reference	YP_001089300.1
Aliases /Synonyms	Cwp84, cell surface-associated cysteine protease, CD630_27870
Reference	PX-P1083
Note	For research use only
Molecular Constructor	Partial Yes

General information on Clostridium Cwp84 Recombinant Protein:

Cwp84 is a Clostridium. difficile surface protein that has recently been shown to possess cysteine protease activity and which is highly immunogenic in patients with C. difficile-associated disease and is likely implicated in the pathogenic process and may have a role in the degradation of extracellular matrices. This enzyme, which appears to be displayed on the bacterial cell surface, exhibited degrading activity against fibronectin, laminin, and vitronectin. Cwp84 plays also a role in maturation of SlpA.

Bradshaw WJ, Roberts AK, Shone CC, Acharya KR. Cwp84, a Clostridium difficile cysteine protease, exhibits conformational flexibility in the absence of its propeptide. Acta Crystallogr F Struct Biol Commun. 2015 Mar;71(Pt 3):295-303. doi: 10.1107/S2053230X15001065. Epub 2015 Feb 19. PubMed PMID: 25760704; PubMed Central PMCID: PMC4356305.
ChapetónMontes D, Candela T, Collignon A, Janoir C. Localization of the Clostridium difficile cysteine protease Cwp84 and insights into its maturation process. J Bacteriol. 2011 Oct;193(19):5314-21. doi: 10.1128/JB.00326-11. Epub 2011 Jul 22. PubMed PMID: 21784932; PubMed Central PMCID: PMC3187449.
de la Riva L, Willing SE, Tate EW, Fairweather NF. Roles of cysteine proteases Cwp84 and Cwp13 in biogenesis of the cell wall of Clostridium difficile. J Bacteriol. 2011 Jul;193(13):3276-85. doi: 10.1128/JB.00248-11. Epub 2011 Apr 29. PubMed PMID: 21531808; PubMed Central PMCID: PMC3133288.
Pantaléon V, Soavelomandroso AP, Bouttier S, Briandet R, Roxas B, Chu M, Collignon A, Janoir C, Vedantam G, Candela T. The Clostridium difficile Protease Cwp84 Modulates both Biofilm Formation and Cell-Surface Properties. PLoS One. 2015 Apr 29;10(4):e0124971. doi: 10.1371/journal.pone.0124971. eCollection 2015. PubMed PMID: 25922949; PubMed Central PMCID: PMC4414356.
Dannheim H, Riedel T, Neumann-Schaal M, Bunk B, Schober I, Spröer C, Chibani CM, Gronow S, Liesegang H, Overmann J, Schomburg D. Manual curation and reannotation of the genomes of Clostridium difficile 630Δerm and C. difficile 630. J Med Microbiol. 2017 Mar;66(3):286-293. doi: 10.1099/jmm.0.000427. PubMed PMID: 28357980.
Monot M, Boursaux-Eude C, Thibonnier M, Vallenet D, Moszer I, Medigue C, Martin-Verstraete I, Dupuy B. Reannotation of the genome sequence of Clostridium difficile strain 630. J Med Microbiol. 2011 Aug;60(Pt 8):1193-9. doi: 10.1099/jmm.0.030452-0. Epub 2011 Feb 24. PubMed PMID: 21349987.
Sebaihia M, Wren BW, Mullany P, Fairweather NF, Minton N, Stabler R, Thomson NR, Roberts AP, Cerdeño-Tárraga AM, Wang H, Holden MT, Wright A, Churcher C, Quail MA, Baker S, Bason N, Brooks K, Chillingworth T, Cronin A, Davis P, Dowd L, Fraser A, Feltwell T, Hance Z, Holroyd S, Jagels K, Moule S, Mungall K, Price C, Rabbinowitsch E, Sharp S, Simmonds M, Stevens K, Unwin L, Whithead S, Dupuy B, Dougan G, Barrell B, Parkhill J. The multidrug-resistant human pathogen Clostridium difficile has a highly mobile, mosaic genome. Nat Genet. 2006 Jul;38(7):779-86. Epub 2006 Jun 25. PubMed PMID: 16804543.

There are no reviews yet.

Be the first to review “Clostridium Cwp84 Recombinant Protein”

Clostridium Cwp84 Recombinant Protein

Clostridium Cwp84 Recombinant Protein

General information on Clostridium Cwp84 Recombinant Protein:

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Clostridium Cwp84 Recombinant Protein

Specifications Clostridium Cwp84 Recombinant Protein

Description

General information on Clostridium Cwp84 Recombinant Protein:

Documents

Publications

Reviews

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Clostridium Cwp84 Recombinant Protein