Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Cow PAG1B Recombinant Protein |
|---|---|
| Uniprot ID | Q29432 |
| Uniprot link | http://www.uniprot.org/uniprot/Q29432 |
| Origin species | Cow |
| Expression system | Prokaryotic expression |
| Sequence | MGHHHHHHHHHHSSGHIEGRHMLEMKWLVLLGLVAFSECIVKIPLRRLKTMRNVVSGKNMLNNFLKEHAYSLSQISFRGS NLTTHPLRNIKDLVYMGNITIGTPPQEFQVVFDTASSDLWVPSDFCTSPACSTHVRFRHLQSSTFRLTNKTFRITYGSGR MKGVVVHDTVRIGNLVSTDQPFGLSIEEYGFEGRIYDGVLGLNYPNISFSGAIPIFDKLKNQRAISEPVFAFYLSKDERE GSVVMFGGVDHRYYEGELNWVPLIQAGDWSVHMDRISIERKIIACSDGCKALVDTGTSDIVGPRRLVNNIHRLIGAIPRG SEHYVPCSEVNTLPSIVFTINGINYPVPGRAYILKDDRGRCYTTFQENRVSSSTETWYLGDVFLRLYFSVFDRGNDRIGL ARAV |
| Molecular weight | 45,67 kDa |
| Purity estimated | 80% |
| Buffer | NaH2PO4 75mM, NaCl 150mM, Urea 6M, pH 6-8. |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Full-length |
| Protein Accession | NP_776836.1 |
| Spec:Entrez GeneID | 281964 |
| Spec:NCBI Gene Aliases | PAG1B |
| Spec:SwissProtID | Q29432 |
| NCBI Reference | NP_776836.1 |
| Aliases /Synonyms | PAG1B, pregnancy-associated glycoprotein 1 precursor, PAG 1, Pregnancy-specific protein B, PSP-B |
| Reference | PX-P1136 |
| Note | For research use only |
Pregnancy associated glycoproteins (PAGs) are widely glycosylated secretory proteins of ruminant trophoblast cells. Bovine pregnancy-associated glycoprotein-1 (PAG-1) may play an important role during pregnancy and is defined as a potential biochemical marker of pregnancy in ungulates.
Send us a message from the form below
Reviews
There are no reviews yet.