Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now

Cow PAG1B Recombinant Protein

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameCow PAG1B Recombinant Protein
Uniprot IDQ29432
Uniprot linkhttp://www.uniprot.org/uniprot/Q29432
Origin speciesCow
Expression systemProkaryotic expression
SequenceMGHHHHHHHHHHSSGHIEGRHMLEMKWLVLLGLVAFSECIVKIPLRRLKTMRNVVSGKNMLNNFLKEHAYSLSQISFRGS NLTTHPLRNIKDLVYMGNITIGTPPQEFQVVFDTASSDLWVPSDFCTSPACSTHVRFRHLQSSTFRLTNKTFRITYGSGR MKGVVVHDTVRIGNLVSTDQPFGLSIEEYGFEGRIYDGVLGLNYPNISFSGAIPIFDKLKNQRAISEPVFAFYLSKDERE GSVVMFGGVDHRYYEGELNWVPLIQAGDWSVHMDRISIERKIIACSDGCKALVDTGTSDIVGPRRLVNNIHRLIGAIPRG SEHYVPCSEVNTLPSIVFTINGINYPVPGRAYILKDDRGRCYTTFQENRVSSSTETWYLGDVFLRLYFSVFDRGNDRIGL ARAV
Molecular weight45,67 kDa
Purity estimated80%
BufferNaH2PO4 75mM, NaCl 150mM, Urea 6M, pH 6-8.
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Protein AccessionNP_776836.1
Spec:Entrez GeneID281964
Spec:NCBI Gene AliasesPAG1B
Spec:SwissProtIDQ29432
NCBI ReferenceNP_776836.1
Aliases /SynonymsPAG1B, pregnancy-associated glycoprotein 1 precursor, PAG 1, Pregnancy-specific protein B, PSP-B
ReferencePX-P1136
NoteFor research use only

Description of Cow PAG1B Recombinant Protein

General information onCow PAG1B Recombinant Protein

Pregnancy associated glycoproteins (PAGs) are widely glycosylated secretory proteins of ruminant trophoblast cells. Bovine pregnancy-associated glycoprotein-1 (PAG-1) may play an important role during pregnancy and is defined as a potential biochemical marker of pregnancy in ungulates.

Publication

  • 1: Szenci O, Karen A, Bajcsy AC, Gáspárdy A, de Sousa NM, Beckers JF. Effect of_x000D_ restraint stress on plasma concentrations of cortisol, progesterone and pregnancy_x000D_ associated-glycoprotein-1 in pregnant heifers during late embryonic development. _x000D_ Theriogenology. 2011 Nov;76(8):1380-5. doi: 10.1016/j.theriogenology.2011.05.030._x000D_ Epub 2011 Aug 26. PubMed PMID: 21872319.
  • _x000D_ _x000D_ _x000D_
  • 2: Xie S, Green J, Beckers JF, Roberts RM. The gene encoding bovine_x000D_ pregnancy-associated glycoprotein-1, an inactive member of the aspartic_x000D_ proteinase family. Gene. 1995 Jul 4;159(2):193-7. PubMed PMID: 7622048.
  • _x000D_ _x000D_ _x000D_
  • 3: Mur-Novales R, López-Gatius F, Serrano-Pérez B, García-Ispierto I, Darwich L, _x000D_ Cabezón O, de Sousa NM, Beckers JF, Almería S. Experimental Neospora Caninum_x000D_ Infection in Pregnant Dairy Heifers Raises Concentrations of Pregnancy-Associated_x000D_ Glycoproteins 1 and 2 in Foetal Fluids. Reprod Domest Anim. 2016 Apr;51(2):282-6._x000D_ doi: 10.1111/rda.12678. Epub 2016 Mar 3. PubMed PMID: 26936628.
  • _x000D_ _x000D_ _x000D_
  • 4: Serrano-Pérez B, Hansen PJ, Mur-Novales R, García-Ispierto I, de Sousa NM,_x000D_ Beckers JF, Almería S, López-Gatius F. Crosstalk between uterine serpin_x000D_ (SERPINA14) and pregnancy-associated glycoproteins at the fetal-maternal_x000D_ interface in pregnant dairy heifers experimentally infected with Neospora_x000D_ caninum. Theriogenology. 2016 Aug;86(3):824-30. doi:_x000D_ 10.1016/j.theriogenology.2016.03.003. Epub 2016 Mar 11. PubMed PMID: 27045629.
  • _x000D_ _x000D_ _x000D_
  • 5: Serrano-Pérez B, Garcia-Ispierto I, de Sousa NM, Beckers JF, Almería S,_x000D_ López-Gatius F. Gamma interferon production and plasma concentrations of_x000D_ pregnancy-associated glycoproteins 1 and 2 in gestating dairy cows naturally_x000D_ infected with Neospora caninum. Reprod Domest Anim. 2014 Apr;49(2):275-80. doi:_x000D_ 10.1111/rda.12267. Epub 2014 Jan 23. PubMed PMID: 24456132.
  • _x000D_ _x000D_ _x000D_
  • 6: Xie SC, Low BG, Nagel RJ, Kramer KK, Anthony RV, Zoli AP, Beckers JF, Roberts _x000D_ RM. Identification of the major pregnancy-specific antigens of cattle and sheep_x000D_ as inactive members of the aspartic proteinase family. Proc Natl Acad Sci U S A. _x000D_ 1991 Nov 15;88(22):10247-51. PubMed PMID: 1946444; PubMed Central PMCID:_x000D_ PMC52905.
  • _x000D_ _x000D_ _x000D_
  • 7: Ishiwata H, Katsuma S, Kizaki K, Patel OV, Nakano H, Takahashi T, Imai K,_x000D_ Hirasawa A, Shiojima S, Ikawa H, Suzuki Y, Tsujimoto G, Izaike Y, Todoroki J,_x000D_ Hashizume K. Characterization of gene expression profiles in early bovine_x000D_ pregnancy using a custom cDNA microarray. Mol Reprod Dev. 2003 May;65(1):9-18._x000D_ PubMed PMID: 12658628.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Cow PAG1B Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Send us a message from the form below

    Cart (0 Items)

    Your cart is currently empty.

    View Products