Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Creatine kinase MB(CKMB)
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Creatine kinase MB(CKMB) |
|---|---|
| Uniprot ID | P06732&P12277 |
| Uniprot link | https://www.uniprot.org/uniprot/P06732 |
| Expression system | Prokaryotic expression |
| Sequence | MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK & MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQKL |
| Molecular weight | 45kDa & 45kDa |
| Protein delivered with Tag? | C-terminal Strep tag & N-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | 50 mM Tris-HCl pH 8.0, 150 mM NaCl |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | CKM(Met1-Lys381)&CKB(Met1-Lys381) |
| Protein Accession | P06732&P12277 |
| Spec:Entrez GeneID | 1158&1152 |
| Spec:NCBI Gene Aliases | CKMM; M-CK; CPK-M |
| Spec:SwissProtID | Q96QL9&Q2LE07 |
| NCBI Reference | P06732&P12277 |
| Aliases /Synonyms | CKMB,Creatine kinase M chain;Creatine phosphokinase M-typeCurated;CPK-M;M-CK & Brain creatine kinase1 Publication;B-CK;Creatine kinase B chain1 Publication;Creatine phosphokinase B-type;CPK-B |
| Reference | PX-P4572 |
| Note | For research use only |
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.