Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Cyclin-dependent kinase inhibitor 2A(CDKN2A) |
|---|---|
| Uniprot ID | P42771 |
| Uniprot link | http://www.uniprot.org/uniprot/P42771 |
| Expression system | Prokaryotic expression |
| Sequence | MGSHHHHHHSGMEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAE PNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAE GPSDIPD |
| Molecular weight | 17.74kDa |
| Purity estimated | 85% by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | full length |
| Aliases /Synonyms | Cyclin-dependent kinase 4 inhibitor A, CDK4I, Multiple tumor suppressor 1, MTS-1, p16-INK4a, p16-INK4, p16INK4A |
| Reference | PX-P4534 |
| Note | For research use only |
CDKN2A, also known as cyclin-dependent kinase inhibitor 2A, is a gene on human chromosome 9 p21.3. By strongly interacting with CDK4 and CDK6, it acts as a negative regulator of normal cell proliferation. This inhibits their ability to interact with cyclin D and phosphorylate retinoblastoma proteins.
Send us a message from the form below
Reviews
There are no reviews yet.