Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cyclin-dependent kinase inhibitor 2A(CDKN2A)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P42771
Molecular weight:
17.74kDa

Original price was: $494.00.Current price is: $392.00.

100ug 21% OFF + 392 loyalty points
full length
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Cyclin-dependent kinase inhibitor 2A(CDKN2A)

Product name Cyclin-dependent kinase inhibitor 2A(CDKN2A)
Uniprot ID P42771
Uniprot link http://www.uniprot.org/uniprot/P42771
Expression system Prokaryotic expression
Raw Antigen Sequence MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Molecular weight 17.74kDa
Purity estimated 85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Aliases /Synonyms Cyclin-dependent kinase 4 inhibitor A, CDK4I, Multiple tumor suppressor 1, MTS-1, p16-INK4a, p16-INK4, p16INK4A
Reference PX-P4534
Note For research use only
Molecular Constructor
full length
Product name Cyclin-dependent kinase inhibitor 2A(CDKN2A)
Uniprot ID P42771
Uniprot link http://www.uniprot.org/uniprot/P42771
Expression system Prokaryotic expression
Raw Antigen Sequence MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Molecular weight 17.74kDa
Purity estimated 85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Aliases /Synonyms Cyclin-dependent kinase 4 inhibitor A, CDK4I, Multiple tumor suppressor 1, MTS-1, p16-INK4a, p16-INK4, p16INK4A
Reference PX-P4534
Note For research use only
Molecular Constructor
full length
Product name PX-P4534-1MG
Uniprot ID P42771
Uniprot link http://www.uniprot.org/uniprot/P42771
Expression system Prokaryotic expression
Raw Antigen Sequence MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Molecular weight 17.74kDa
Purity estimated 85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Aliases /Synonyms Cyclin-dependent kinase 4 inhibitor A, CDK4I, Multiple tumor suppressor 1, MTS-1, p16-INK4a, p16-INK4, p16INK4A
Reference PX-P4534
Note For research use only
Molecular Constructor
full length

General Information about Cyclin-dependent kinase inhibitor 2A(CDKN2A)

CDKN2A, also known as cyclin-dependent kinase inhibitor 2A, is a gene on human chromosome 9 p21.3. By strongly interacting with CDK4 and CDK6, it acts as a negative regulator of normal cell proliferation. This inhibits their ability to interact with cyclin D and phosphorylate retinoblastoma proteins.

Cyclin-dependent kinase inhibitor 2A(CDKN2A)

There are no reviews yet.

Be the first to review “Cyclin-dependent kinase inhibitor 2A(CDKN2A)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products