Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Glutamate racemase(murI)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
B5QXR2
Molecular weight:
34.22kDa

$250.00

+ 250 loyalty points
full length
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Glutamate racemase(murI)

Product name Glutamate racemase(murI)
Uniprot ID B5QXR2
Uniprot link http://www.uniprot.org/uniprot/B5QXR2
Expression system Prokaryotic expression
Sequence MGKYLLPTAAAGLLLLAAQPAMAMATKLQDENTPCLAATPSEPRPTVLVFDSGVGGLSVYDEIRRLLPDLHYIYAFDNVA FPYGEKSETFIVERVVEIVTAVQQRYPLSLAVIACNTASTVSLPALREKFAFPVVGVVPAIKPAARLTANGVVGLLATRA TVKRPYTHELIARFANECQIAMLGSAELVELAEAKLHGDSVSLEELRRILRPWLRMPEPPDTVVLGCTHFPLLRDELLQV LPEGTRLVDSGAAIARRTAWLLEHEAPDAKSTDANIAYCMAMTPGAEQLLPVLQRYGFETLEKLPVGSHHHHHH
Molecular weight 34.22kDa
Purity estimated 90% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Reference PX-P4527
Note For research use only
Molecular Constructor
full length
Product name Glutamate racemase(murI)
Uniprot ID B5QXR2
Uniprot link http://www.uniprot.org/uniprot/B5QXR2
Expression system Prokaryotic expression
Sequence MGKYLLPTAAAGLLLLAAQPAMAMATKLQDENTPCLAATPSEPRPTVLVFDSGVGGLSVYDEIRRLLPDLHYIYAFDNVA FPYGEKSETFIVERVVEIVTAVQQRYPLSLAVIACNTASTVSLPALREKFAFPVVGVVPAIKPAARLTANGVVGLLATRA TVKRPYTHELIARFANECQIAMLGSAELVELAEAKLHGDSVSLEELRRILRPWLRMPEPPDTVVLGCTHFPLLRDELLQV LPEGTRLVDSGAAIARRTAWLLEHEAPDAKSTDANIAYCMAMTPGAEQLLPVLQRYGFETLEKLPVGSHHHHHH
Molecular weight 34.22kDa
Purity estimated 90% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Reference PX-P4527
Note For research use only
Molecular Constructor
full length

General Information about Glutamate racemase (murI)

Provides the (R)-glutamate required for cell wall biosynthesis.

There are no reviews yet.

Be the first to review “Glutamate racemase(murI)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products