Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

G1-S specific cyclin-D2(CCND2)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P30279
Molecular weight:
33.07 kDa

Original price was: $431.00.Current price is: $392.00.

100ug 9% OFF + 392 loyalty points
His Met1–Leu289
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

G1-S specific cyclin-D2(CCND2)

Product name G1-S specific cyclin-D2(CCND2)
Uniprot ID P30279
Uniprot link https://www.uniprot.org/uniprot/P30279
Expression system Prokaryotic expression
Raw Antigen Sequence MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
Molecular weight 33.07 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu289
Protein Accession P30279
Spec:Entrez GeneID 894
Spec:NCBI Gene Aliases MPPH3; KIAK0002
Spec:SwissProtID Q13955
NCBI Reference P30279
Reference PX-P4713
Note For research use only
Molecular Constructor
His Met1–Leu289
Product name G1-S specific cyclin-D2(CCND2)
Uniprot ID P30279
Uniprot link https://www.uniprot.org/uniprot/P30279
Expression system Prokaryotic expression
Raw Antigen Sequence MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
Molecular weight 33.07 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu289
Protein Accession P30279
Spec:Entrez GeneID 894
Spec:NCBI Gene Aliases MPPH3; KIAK0002
Spec:SwissProtID Q13955
NCBI Reference P30279
Reference PX-P4713
Note For research use only
Molecular Constructor
His Met1–Leu289
Product name PX-P4713-1MG
Uniprot ID P30279
Uniprot link https://www.uniprot.org/uniprot/P30279
Expression system Prokaryotic expression
Raw Antigen Sequence MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
Molecular weight 33.07 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu289
Protein Accession P30279
Spec:Entrez GeneID 894
Spec:NCBI Gene Aliases MPPH3; KIAK0002
Spec:SwissProtID Q13955
NCBI Reference P30279
Reference PX-P4713
Note For research use only
Molecular Constructor
His Met1–Leu289

G1-S specific cyclin-D2(CCND2)

There are no reviews yet.

Be the first to review “G1-S specific cyclin-D2(CCND2)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products