Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Discosoma Plum Recombinant Protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Discosoma Plum Recombinant Protein |
|---|---|
| Uniprot ID | Q5S3G7 |
| Uniprot link | http://www.uniprot.org/uniprot/Q5S3G7 |
| Origin species | Discosoma |
| Expression system | Prokaryotic expression |
| Sequence | MAHNHRHKHKLMVSKGEEVIKEFMRFKEHMEGSVNGHEFEIEGEGEGRPYEGTQTARLKVTKGGPLPFAWDILSPQIMYG SKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKVRGTNFPSDGPVMQKKTMGWEASSE RMYPEDGALKGEMKMRLRLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHSTGA |
| Molecular weight | 26,93 kDa |
| Purity estimated | >95% |
| Buffer | PBS, imidazole 200mM |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Full-length |
| Protein Accession | AAV65487.1 |
| Spec:SwissProtID | Q5S3G7 |
| NCBI Reference | AAV65487.1 |
| Aliases /Synonyms | Plum, Fluorescent protein plum |
| Reference | PX-P1143 |
| Note | For research use only |
Description of Discosoma Plum Recombinant Protein
General information on Discosoma Plum Recombinant Protein
Far-red fluorescent protein that avoid the natural green autofluorescence found in plants and animals, and are preferred for in vivo imaging.
Related products
Biosimilar
Ulocuplumab Biosimilar – Anti-CXCR4, CD184 mAb – Research Grade
PX-TA1339 238$Contact us
Send us a message from the form below
Reviews
There are no reviews yet.