Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Discosoma Plum Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Discosoma
Uniprot ID:
Q5S3G7
Molecular weight:
26,93 kDa

$250.00

+ 250 loyalty points
Full-length
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Discosoma Plum Recombinant Protein

Discosoma Plum Recombinant Protein

Product name Discosoma Plum Recombinant Protein
Uniprot ID Q5S3G7
Uniprot link http://www.uniprot.org/uniprot/Q5S3G7
Origin species Discosoma
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMVSKGEEVIKEFMRFKEHMEGSVNGHEFEIEGEGEGRPYEGTQTARLKVTKGGPLPFAWDILSPQIMYG SKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKVRGTNFPSDGPVMQKKTMGWEASSE RMYPEDGALKGEMKMRLRLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHSTGA
Molecular weight 26,93 kDa
Purity estimated >95%
Buffer PBS, imidazole 200mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession AAV65487.1
Spec:SwissProtID Q5S3G7
NCBI Reference AAV65487.1
Aliases /Synonyms Plum, Fluorescent protein plum
Reference PX-P1143
Note For research use only
Molecular Constructor
Full-length
Product name Discosoma Plum Recombinant Protein
Uniprot ID Q5S3G7
Uniprot link http://www.uniprot.org/uniprot/Q5S3G7
Origin species Discosoma
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMVSKGEEVIKEFMRFKEHMEGSVNGHEFEIEGEGEGRPYEGTQTARLKVTKGGPLPFAWDILSPQIMYG SKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKVRGTNFPSDGPVMQKKTMGWEASSE RMYPEDGALKGEMKMRLRLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHSTGA
Molecular weight 26,93 kDa
Purity estimated >95%
Buffer PBS, imidazole 200mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession AAV65487.1
Spec:SwissProtID Q5S3G7
NCBI Reference AAV65487.1
Aliases /Synonyms Plum, Fluorescent protein plum
Reference PX-P1143
Note For research use only
Molecular Constructor
Full-length

General information on Discosoma Plum Recombinant Protein

Far-red fluorescent protein that avoid the natural green autofluorescence found in plants and animals, and are preferred for in vivo imaging.

  • Wang L, Jackson WC, Steinbach PA, Tsien RY. Evolution of new nonantibody proteins via iterative somatic hypermutation. Proc Natl Acad Sci U S A. 2004 Nov 30;101(48):16745-9. Epub 2004 Nov 19. PubMed PMID: 15556995; PubMed Central PMCID: PMC529417.

There are no reviews yet.

Be the first to review “Discosoma Plum Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products