Cart (0 Items)
Your cart is currently empty.
View Products
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Disintegrin and metalloproteinase domain-containing protein 10(ADAM10) |
|---|---|
| Uniprot ID | O14672 |
| Uniprot link | https://www.uniprot.org/uniprot/O14672 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | TTSAEKYTCQLYIQTDHLFFKYYGTREAVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKD PTNPFRFPNIGVEKFLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKS LNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNN NKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKLKPGK QCS |
| Molecular weight | 32.34 kDa |
| Protein delivered with Tag? | N terminus His tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH 7.5, 0.02% SKL |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Thr214-Ser504 |
| Protein Accession | O14672 |
| Spec:Entrez GeneID | 102 |
| Spec:NCBI Gene Aliases | RAK; kuz; AD10; AD18; MADM; CD156c; CDw156; HsT18717 |
| Spec:SwissProtID | Q92650 |
| NCBI Reference | O14672 |
| Aliases /Synonyms | ADAM 10,CDw156,Kuzbanian protein homolog,Mammalian disintegrin-metalloprotease,CD_antigen: CD156c,KUZ, MADM |
| Reference | PX-P4796 |
| Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.