Cart (0 Items)
Your cart is currently empty.
View Products
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | DNA-binding protein H-NS (hns) |
|---|---|
| Uniprot ID | P0ACF9 |
| Uniprot link | https://www.uniprot.org/uniprot/P0ACF9 |
| Expression system | Prokaryotic expression |
| Sequence | MGSHHHHHHSGLEVLFQGPMSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQY REMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ |
| Molecular weight | 17.63kDa |
| Purity estimated | 40% by SDS-PAGE |
| Buffer | 20 mM Tris HCl, pH 8.0, 2 mM MgCl2, and 20 mM NaCl |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Met12-Gln156 |
| Aliases /Synonyms | DNA-binding protein H-NS, Histone-like protein HLP-II, Protein B1, Protein H1 |
| Reference | PX-P4380 |
| Note | For research use only |
Send us a message from the form below
Reviews
There are no reviews yet.