Name: DnaJ homolog subfamily C member 5B(Dnajc5b)
SKU: PX-P4808
Availability: InStock

Product name	DnaJ homolog subfamily C member 5B(Dnajc5b)
Uniprot ID	Q9CQ94
Uniprot link	https://www.uniprot.org/uniprot/Q9CQ94
Origin species	House Mouse
Expression system	Prokaryotic expression
Sequence	MGMACNAPNQRQRTLSTSGESLYEILGLHKGASCEEIKKTYRKLALRHHPDKNPDDPSAAEKFKEINNAHTILTDTSKRNIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKTLFIIIGLLTGCYFCCCLCCCCNCCCGHCRPKSSTPEEEFYVSPEDLEEQIRTDMEKDMDFPVVLQPTNTNEKTQLIREGSRSYCTDSLEHHHHHH
Purity estimated	>15% by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Met1-Ser199
Aliases /Synonyms	Cysteine string protein beta,CSP-beta
Reference	PX-P4808
Note	For research use only

No Products found