Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

DnaJ homolog subfamily C member 5B(Dnajc5b)

Host species:
Escherichia coli (E.coli)
Origin species:
House Mouse
Uniprot ID:
Q9CQ94

Original price was: $288.00.Current price is: $250.00.

50ug 13% OFF + 250 loyalty points
Met1–Ser199
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

DnaJ homolog subfamily C member 5B(Dnajc5b)

Product name DnaJ homolog subfamily C member 5B(Dnajc5b)
Uniprot ID Q9CQ94
Uniprot link https://www.uniprot.org/uniprot/Q9CQ94
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MACNAPNQRQRTLSTSGESLYEILGLHKGASCEEIKKTYRKLALRHHPDKNPDDPSAAEKFKEINNAHTILTDTSKRNIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKTLFIIIGLLTGCYFCCCLCCCCNCCCGHCRPKSSTPEEEFYVSPEDLEEQIRTDMEKDMDFPVVLQPTNTNEKTQLIREGSRSYCTDS
Purity estimated >15% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser199
Aliases /Synonyms Cysteine string protein beta,CSP-beta
Reference PX-P4808
Note For research use only
Molecular Constructor
Met1–Ser199
Product name DnaJ homolog subfamily C member 5B(Dnajc5b)
Uniprot ID Q9CQ94
Uniprot link https://www.uniprot.org/uniprot/Q9CQ94
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MACNAPNQRQRTLSTSGESLYEILGLHKGASCEEIKKTYRKLALRHHPDKNPDDPSAAEKFKEINNAHTILTDTSKRNIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKTLFIIIGLLTGCYFCCCLCCCCNCCCGHCRPKSSTPEEEFYVSPEDLEEQIRTDMEKDMDFPVVLQPTNTNEKTQLIREGSRSYCTDS
Purity estimated >15% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser199
Aliases /Synonyms Cysteine string protein beta,CSP-beta
Reference PX-P4808
Note For research use only
Molecular Constructor
Met1–Ser199
Product name PX-P4808-1MG
Uniprot ID Q9CQ94
Uniprot link https://www.uniprot.org/uniprot/Q9CQ94
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MACNAPNQRQRTLSTSGESLYEILGLHKGASCEEIKKTYRKLALRHHPDKNPDDPSAAEKFKEINNAHTILTDTSKRNIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKTLFIIIGLLTGCYFCCCLCCCCNCCCGHCRPKSSTPEEEFYVSPEDLEEQIRTDMEKDMDFPVVLQPTNTNEKTQLIREGSRSYCTDS
Purity estimated >15% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser199
Aliases /Synonyms Cysteine string protein beta,CSP-beta
Reference PX-P4808
Note For research use only
Molecular Constructor
Met1–Ser199

DnaJ homolog subfamily C member 5B(Dnajc5b)

There are no reviews yet.

Be the first to review “DnaJ homolog subfamily C member 5B(Dnajc5b)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products