Name: Early secreted antigenic target 6 kDa (esxA)
SKU: PX-P4753-10
Availability: InStock

Product name	Early secreted antigenic target 6 kDa (esxA)
Uniprot ID	P9WNK6
Uniprot link	https://www.uniprot.org/uniprot/P9WNK6
Expression system	Prokaryotic expression
Sequence	MGPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPMTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQ*
Molecular weight	33.87kDa
Protein delivered with Tag?	N-terminal GST Tag
Purity estimated	>20% by SDS-PAGE
Buffer	TBS, pH8.0
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Met1-Gln70
Protein Accession	P9WNK6
Spec:SwissProtID	Q540D8
NCBI Reference	P9WNK6
Aliases /Synonyms	ESXA_MYCTO
Reference	PX-P4753
Note	For research use only

No Products found