Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Early secreted antigenic target 6 kDa (esxA)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P9WNK6
Molecular weight:
33.87kDa

$217.00

50ug + 217 loyalty points
GST Met1–Gln70
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Early secreted antigenic target 6 kDa (esxA)

Product name Early secreted antigenic target 6 kDa (esxA)
Uniprot ID P9WNK6
Uniprot link https://www.uniprot.org/uniprot/P9WNK6
Expression system Prokaryotic expression
Raw Antigen Sequence MGPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPMTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQ*
Molecular weight 33.87kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >20% by SDS-PAGE
Buffer TBS, pH8.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gln70
Protein Accession P9WNK6
Spec:SwissProtID Q540D8
NCBI Reference P9WNK6
Aliases /Synonyms ESXA_MYCTO
Reference PX-P4753
Note For research use only
Molecular Constructor
GST Met1–Gln70
Product name Early secreted antigenic target 6 kDa (esxA)
Uniprot ID P9WNK6
Uniprot link https://www.uniprot.org/uniprot/P9WNK6
Expression system Prokaryotic expression
Raw Antigen Sequence MGPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPMTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQ*
Molecular weight 33.87kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >20% by SDS-PAGE
Buffer TBS, pH8.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gln70
Protein Accession P9WNK6
Spec:SwissProtID Q540D8
NCBI Reference P9WNK6
Aliases /Synonyms ESXA_MYCTO
Reference PX-P4753
Note For research use only
Molecular Constructor
GST Met1–Gln70

There are no reviews yet.

Be the first to review “Early secreted antigenic target 6 kDa (esxA)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products