Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Monkeypox virus/MPXV B21R Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Monkeypox virus (strain Zaire-96-I-16) (MPX)
Uniprot ID:
Q3I8H3
Molecular weight:
24.31 kDa

$359.00

100ug + 359 loyalty points
His Thr291–Thr487
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Monkeypox virus/MPXV B21R Recombinant Protein, N-His

Monkeypox virus/MPXV B21R Recombinant Protein, N-His

Product name Monkeypox virus/MPXV B21R Recombinant Protein, N-His
Uniprot ID Q3I8H3
Origin species Monkeypox virus (strain Zaire-96-I-16) (MPX)
Expression system Prokaryotic expression
Raw Antigen Sequence TSNCDKCSMNLMASVIPAVNEFNNTLMKIGVKDDENNTVYNYYICKLTTNSTCDELINLDEVINNITLTNIIRNSVSTTNSRKRRDLNGEFEFSTSKELDCLYESYGVNDDISHCFASPRRRRSDDKKEYMDMKLFDHAKKDLGIDSVIPRGTTHFQVGASGASGGVVGDSFPFQNVKSRASLLAEKIMPRVPITAT
Molecular weight 24.31 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer Supplied as solution form in PBS pH 7.4.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr291-Thr487
Aliases /Synonyms B21R, Putative membrane-associated glycoprotein, Surface glycoprotein, MPXV-CAM1990_02-171, MPXV-Congo_8-172, MPXV-GAB1988_001-171, MPXV-Ikubi-171, MPXV_RCG2003_358_197, MPXV_SUD2005_01_192, MPXV_ZAI1979_005_197, MPXVgp182, Monkeypox virus (MPXV), clade 2
Reference PX-P6076
Note For research use only.
Molecular Constructor
His Thr291–Thr487

Monkeypox virus/MPXV B21R Recombinant Protein, N-His

There are no reviews yet.

Be the first to review “Monkeypox virus/MPXV B21R Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products