Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Monkeypox virus/MPXV A44R Protein, N-GST &amp C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Monkeypox virus (strain Zaire-96-I-16) (MPX)
Uniprot ID:
A0A7H0DNE1
Molecular weight:
36.43 kDa

$359.00

100ug + 359 loyalty points
GST Asp2–Thr74 amp C-terminal His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Monkeypox virus/MPXV A44R Protein, N-GST &amp C-His

Product name Recombinant Monkeypox virus/MPXV A44R Protein, N-GST & C-His
Uniprot ID A0A7H0DNE1
Origin species Monkeypox virus (strain Zaire-96-I-16) (MPX)
Expression system Prokaryotic expression
Raw Antigen Sequence DKIKITIDSKIGNVVTISYNLEKITIDVTPKKKKEKDVLLAQSVAVEEAKDVKVEEKNIIDIEDDDDMDIENT
Molecular weight 36.43 kDa
Protein delivered with Tag? N-terminal GST Tag & amp C-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp2-Thr74
Aliases /Synonyms Monkeypox A44R, clade 2
Reference PX-P6010
Note For research use only.
Molecular Constructor
GST Asp2–Thr74 amp C-terminal His

SDS-PAGE For Recombinant Monkeypox virus/MPXV A44R Protein, N-GST & C-His

SDS-PAGE For Recombinant Monkeypox virus/MPXV A44R Protein, N-GST &amp C-His

Recombinant Monkeypox virus/MPXV A44R Protein, N-GST & C-His, on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.

Recombinant Monkeypox virus/MPXV A44R Protein, N-GST &amp C-His

There are no reviews yet.

Be the first to review “Recombinant Monkeypox virus/MPXV A44R Protein, N-GST &amp C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products