Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Monkeypox virus/MPXV A14L Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Monkeypox virus (strain Zaire-96-I-16) (MPX)
Uniprot ID:
P0DTN1
Molecular weight:
33.44 kDa

$359.00

100ug + 359 loyalty points
GST Asn24–Ala70 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Monkeypox virus/MPXV A14L Protein

Product name Recombinant Monkeypox virus/MPXV A14L Protein
Uniprot ID P0DTN1
Origin species Monkeypox virus (strain Zaire-96-I-16) (MPX)
Expression system Prokaryotic expression
Raw Antigen Sequence NKIKNPQNPNPSPNLNSPPPETRNTKFVNNLEKDHISSLYNLVKSSA
Molecular weight 33.44 kDa
Protein delivered with Tag? N-terminal GST and C-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn24-Ala70
Aliases /Synonyms A14L, Monkeypox virus/MPXV, clade 2
Reference PX-P6060
Note For research use only.
Molecular Constructor
GST Asn24–Ala70 His

The recombinant Monkeypox virus A14L protein (MPXV A14L) is produced in an Escherichia coli expression system and purified for use in research applications. Viral structural proteins such as A14L are important components of orthopoxvirus biology and are commonly used in studies investigating viral replication, host–virus interactions, and antiviral strategies.

This recombinant MPXV protein enables researchers to study Monkeypox virus protein structure, immune responses, and viral pathogenesis in controlled experimental systems.

Biological Background

Monkeypox virus (MPXV) is a member of the Orthopoxvirus genus, which also includes variola virus and vaccinia virus. Viral structural proteins play important roles in virus assembly and infection processes.

The A14L protein is associated with viral membrane formation and structural organization during the viral replication cycle. Recombinant viral proteins are widely used for:

  • virology research
  • vaccine and antigen development
  • antibody generation
  • viral protein characterization
  • host–virus interaction studies

Applications

This recombinant MPXV A14L protein can be used in multiple experimental applications, including:

  • ELISA development and antigen detection assays
  • antibody generation and validation
  • viral protein interaction studies
  • immunological assays
  • structural and biochemical studies

Recombinant Monkeypox Protein Price

ProteoGenix offers competitive pricing for recombinant viral proteins, allowing laboratories to access high-quality reagents while controlling research costs.

Our recombinant proteins are produced under controlled conditions to ensure reproducibility, purity, and consistent experimental performance.

Research Use Only (RUO): This product is intended for laboratory research purposes only and is not intended for diagnostic, therapeutic, or clinical use

Related Services

SDS-PAGE For Recombinant Monkeypox virus/MPXV A14L Protein

SDS-PAGE For Recombinant Monkeypox virus/MPXV A14L Protein

Recombinant Monkeypox virus/MPXV A14L Protein, on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue.

Recombinant Monkeypox virus/MPXV A14L Protein

There are no reviews yet.

Be the first to review “Recombinant Monkeypox virus/MPXV A14L Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products