Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Monkeypox virus/MPXV A30L Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Monkeypox virus (strain Zaire-96-I-16) (MPX)
Uniprot ID:
Q8V4U9
Molecular weight:
15.70 kDa

$359.00

100ug + 359 loyalty points
His Glu28–Leu146
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE For Monkeypox virus/MPXV A30L Recombinant Protein, N-His
Monkeypox virus/MPXV A30L Recombinant Protein, N-His

Monkeypox virus/MPXV A30L Recombinant Protein, N-His

Product name Monkeypox virus/MPXV A30L Recombinant Protein, N-His
Uniprot ID Q8V4U9
Origin species Monkeypox virus (strain Zaire-96-I-16) (MPX)
Expression system Prokaryotic expression
Raw Antigen Sequence ENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMRQCIDFTFSDVINIDIYNPCIAPNINNTECQFLKSVL
Molecular weight 15.70 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer Lyophilized from PBS pH7.4,0.02%NLS,1mM EDTA, 4%trehalose,1% mannitol
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu28-Leu146
Aliases /Synonyms Envelope protein A28 homolog, Protein A30, A30L, Monkeypox virus (MPXV), clade 2
Reference PX-P6073
Note For research use only.
Molecular Constructor
His Glu28–Leu146

SDS-PAGE For Monkeypox virus/MPXV A30L Recombinant Protein, N-His

SDS-PAGE For Monkeypox virus/MPXV A30L Recombinant Protein, N-His

Monkeypox virus/MPXV A30L Recombinant Protein, N-His, on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.

Monkeypox virus/MPXV A30L Recombinant Protein, N-His

There are no reviews yet.

Be the first to review “Monkeypox virus/MPXV A30L Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products